DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17637 and CG31321

DIOPT Version :9

Sequence 1:NP_649237.1 Gene:CG17637 / 40275 FlyBaseID:FBgn0037004 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_731899.1 Gene:CG31321 / 318681 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster


Alignment Length:502 Identity:90/502 - (17%)
Similarity:173/502 - (34%) Gaps:114/502 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 RVLLVDGLVYGVR----GILGFVTTPVMGAISD-FHGRKVVMLLAVATTYAPIPFMMLKSWWFFA 116
            ::|..|  |.|.|    .|...:.....|..:| ::.||..|::.:..........::.|.:|.:
  Fly   128 QILAAD--VSGKRAPMAAIFPLIVLLFAGGWADRYNKRKPCMIMPIIGEALSFTCQIISSIFFES 190

  Fly   117 I-LTVSSIC---------GSTY--SSSLAYVADTTTVENRSKGYGFVAASFGAGIAF-SPSLGNY 168
            : :...:.|         |.|:  .:..:|:...|..|:|...:| :.|.|..|:.| ...:...
  Fly   191 LPMEFGAYCEAIVPALFGGLTFCLMAIYSYITIATPEEDRVFRFG-IFAMFVTGVPFIGQPISGV 254

  Fly   169 LMKSYGSASVILIATITGMINILFIIFAVPESLVLKEKKVILNE-------------NNDNKV-E 219
            |..:.|.......|.:..:|.|.:|||.:.|...........||             ..||.. |
  Fly   255 LFTTLGYTWSFASAIVFQLIAIFYIIFFIKEVKTTPTTSTTANEPPPLPTSLPPKQQGADNMAYE 319

  Fly   220 DTKVDDISPKEKKENLNGEGKVNVEVN---KPTSQNIVTNKELDQQFSKEENLQNDLTEKEKIDN 281
            .|.:|:         |.|...||.::.   :|..:.:...:.|               .||..|.
  Fly   320 TTNLDE---------LQGNKNVNFQLTPQMEPKVEVVPPKRSL---------------LKELFDP 360

  Fly   282 GSLNSSDLWEVLRKSRKDKNLLVIYLIT-FLSIWPFAGVD---------------STAPVYLKTN 330
            ..:.....:.::::....:.||::.|.. ||::.|.:|.:               :...:||..:
  Fly   361 TLVLDCIRFPLVKRPNNGRMLLILLLCAYFLTVGPTSGENDYWYRFTLKKLAWNGNDFSIYLTLS 425

  Fly   331 MGFEYEEVSMMLGLLSVLAITSNILLGYIMNIVGAKWSIRLGLLLLFLQMLFFGFGTHHWMYWLS 395
            .|.......:...:||.|...|:.::|            .|..|.:....:.|.|.:....::::
  Fly   426 SGAALVGTFIGTAILSKLLKVSDSMIG------------MLSALSIVCSRVLFAFSSSTASFYVA 478

  Fly   396 SILAALATIIPAANNAVASIYASPDNRGAVLGIISGIECLSEGVGPAFFGLLFFIFQDDSETDLK 460
            .::....::...|...:.|...:.|....:..|....|.:::.:.|..|..::     .|..|  
  Fly   479 GVVDMFVSLRVIAIKTIGSSIVAGDELSKMYSIFGISEPIAQFIFPPIFSEIY-----KSTVD-- 536

  Fly   461 VNSPISMP---------FVISAISVFVAIVLSSFIKKDTLGNEETRV 498
                 |.|         |.|..:.||   |:..|:.:....|||..|
  Fly   537 -----SFPGAIWLFGEIFYIPNVLVF---VVCYFLLRRRKANEEKSV 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17637NP_649237.1 MFS 25..487 CDD:119392 86/489 (18%)
MFS_1 30..441 CDD:284993 74/434 (17%)
CG31321NP_731899.1 MFS 141..>271 CDD:119392 23/130 (18%)
MFS_1 143..>271 CDD:284993 23/128 (18%)
MFS <379..559 CDD:119392 34/206 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.