DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17637 and SLC46A3

DIOPT Version :9

Sequence 1:NP_649237.1 Gene:CG17637 / 40275 FlyBaseID:FBgn0037004 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001129391.1 Gene:SLC46A3 / 283537 HGNCID:27501 Length:463 Species:Homo sapiens


Alignment Length:414 Identity:82/414 - (19%)
Similarity:152/414 - (36%) Gaps:109/414 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 IEKLSGSFGNRVLLVDGLVYGVRGILGFVTTPVMGAISDFHGRKVVMLL----AVATT------- 100
            ::|....| |..:.:.||      |.|.|:|.::.:|||.:|||..|:|    |:||:       
Human    65 VQKKVSRF-NLQMDISGL------IPGLVSTFILLSISDHYGRKFPMILSSVGALATSVWLCLLC 122

  Fly   101 YAPIPFMMLKSWWFFAILTVSSICG---STYSSSLAYVADTTTVENRSKGYGFVAASFGAGI--A 160
            |...||.:|     .|...:.:.||   :.:.:..||:.|... |::.|........|..|:  .
Human   123 YFAFPFQLL-----IASTFIGAFCGNYTTFWGACFAYIVDQCK-EHKQKTIRIAIIDFLLGLVTG 181

  Fly   161 FSPSLGNYLMKSYGSASVILIATITGMINILFIIFAVPESLVLKEKKVILNENNDNKVEDTKVDD 225
            .:.....|.::..|.....||..::..:|:::|:|.:.:                          
Human   182 LTGLSSGYFIRELGFEWSFLIIAVSLAVNLIYILFFLGD-------------------------- 220

  Fly   226 ISPKEKKENLNGEGKVNVEVNKPTSQNIVTNKELDQQFSKEENLQNDLTEKEKIDNGSLNSSDLW 290
                              .|.:.:|||:.        .|..|..:|.....              
Human   221 ------------------PVKECSSQNVT--------MSCSEGFKNLFYRT-------------- 245

  Fly   291 EVLRKSRKDKNLLVIYLITFLSIWPFAGVDSTAPVYL--KTNMGFEYEEVSMMLG--LLSVLAIT 351
            .:|.|:...|...::.|:.|..|..|..|...||:::  :.:....:.||.:..|  |.|...:|
Human   246 YMLFKNASGKRRFLLCLLLFTVITYFFVVIGIAPIFILYELDSPLCWNEVFIGYGSALGSASFLT 310

  Fly   352 SNI---LLGYIMNIVGAKWSIRLGLLLLFLQMLFFGFGTHHWMYWLSSILAALATIIP--AANNA 411
            |.:   |..|.|..:...:   :|:......|....|.:...|.:|:.: ..|.||:|  ...:.
Human   311 SFLGIWLFSYCMEDIHMAF---IGIFTTMTGMAMTAFASTTLMMFLARV-PFLFTIVPFSVLRSM 371

  Fly   412 VASIYASPDNRGAVLGIISGIECL 435
            ::.:..|.: :|.:...|:.:|.|
Human   372 LSKVVRSTE-QGTLFACIAFLETL 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17637NP_649237.1 MFS 25..487 CDD:119392 82/414 (20%)
MFS_1 30..441 CDD:284993 82/414 (20%)
SLC46A3NP_001129391.1 MFS_1 81..399 CDD:311564 78/397 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5729
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.