DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17637 and MFSD10

DIOPT Version :10

Sequence 1:NP_649237.1 Gene:CG17637 / 40275 FlyBaseID:FBgn0037004 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001397632.1 Gene:MFSD10 / 10227 HGNCID:16894 Length:480 Species:Homo sapiens


Alignment Length:194 Identity:37/194 - (19%)
Similarity:63/194 - (32%) Gaps:68/194 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 DTSSPD-----WSKRNDRRSRERGEKEQEMDRYEREAERERSRKEREQRRKLEDAERAYQTRLRQ 334
            |..|||     |.               ::..|:.:....:|.:|.:..                
Human   543 DCESPDLYPVGWC---------------QLTGYQLQPPASQSSRESQSA---------------- 576

  Fly   335 WERREREKEKERQYEKEKEKEKERKRKKEI-------------RYEEEEEEDDDDSRRRWHRAAL 386
             ..::::|.|.:||:..|:|.|....||.:             .:..:||......|....:.||
Human   577 -SSKQKKKAKSQQYKGHKKKRKMPVGKKPVSLSSLPMTGGVRRSFSGDEELTPPPYRTLPAQTAL 640

  Fly   387 D----ERRRRQLREKEDDL-ADRLKEEEEVAEAKRSAEEQNLQQQQLDALRILSGQAAIGSETV 445
            :    ....|:.|...:.: |.:||||             .|..::...|...|.|.:.||.||
Human   641 EAFPPPSTSREFRPSLNTVTASQLKEE-------------LLDGEEYSFLHGASDQESNGSATV 691

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17637NP_649237.1 MFS 25..487 CDD:475125 37/194 (19%)
MFSD10NP_001397632.1 MFS 51..426 CDD:475125
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.