DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17637 and LOC100002406

DIOPT Version :9

Sequence 1:NP_649237.1 Gene:CG17637 / 40275 FlyBaseID:FBgn0037004 Length:504 Species:Drosophila melanogaster
Sequence 2:XP_017213485.1 Gene:LOC100002406 / 100002406 -ID:- Length:424 Species:Danio rerio


Alignment Length:309 Identity:56/309 - (18%)
Similarity:88/309 - (28%) Gaps:140/309 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LKFLRPLVKVLVNRSGIGKASVWHAVIVTFMHYF-SWGLL--------------TVPFIEKLSGS 53
            :.||..::...|...|..|.    .::|..:.|| |.|||              .||.|..|.|.
Zfish    61 MPFLPAILLAKVGDRGYRKV----PIVVPLVGYFLSRGLLLLDVAFDWPLQVLYAVPVIHGLCGG 121

  Fly    54 FGNR-------------------VLLVDGLVYGVRGILGFVTTPVMGAISDFHGRKVVMLLAVAT 99
            |.:.                   .:::..||||:.|.:|                          
Zfish   122 FASYWAGVMALVSVSSGEEERSVSIMMTELVYGIAGFIG-------------------------- 160

  Fly   100 TYAPIPFMMLKSWWFFAILTVS-----SICGST---YSSSLAYVADTTTVE---------NRSKG 147
                    .|.|...||:.||:     .:.||:   |...|.|.|....|.         .|.:.
Zfish   161 --------SLASGHLFALYTVNLKQGVILSGSSVVLYLLCLLYAATFLRVGPPAVLGDRLERRES 217

  Fly   148 YGF----------VAASFGAGIAFS-------PSLGNYLMK----------SYGSA--------- 176
            :|.          :|..|.:||.:.       ..|..|::|          .||:|         
Zfish   218 FGIINHEARDKINIALLFVSGILYDIAVAGGMEMLAAYVLKEPLNWGATLVGYGNAAGSLLFITS 282

  Fly   177 ---------------SVILIATITGMINILFIIFAVPESLVLKEKKVIL 210
                           |:|::..::....|.|:.|.....:....:.|.|
Zfish   283 FLGVKMFTRLSLRDESMIMVGMVSFATGIYFMAFVTTTPMYFLARSVTL 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17637NP_649237.1 MFS 25..487 CDD:119392 51/288 (18%)
MFS_1 30..441 CDD:284993 51/283 (18%)
LOC100002406XP_017213485.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5729
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.