DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18281 and SGE1

DIOPT Version :9

Sequence 1:NP_649236.1 Gene:CG18281 / 40274 FlyBaseID:FBgn0037003 Length:542 Species:Drosophila melanogaster
Sequence 2:NP_015524.1 Gene:SGE1 / 856327 SGDID:S000006402 Length:543 Species:Saccharomyces cerevisiae


Alignment Length:207 Identity:47/207 - (22%)
Similarity:85/207 - (41%) Gaps:50/207 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 KSRKDKNLLVIYLITFLSIWPFAGVDSTAPVYLKTNMGFEYEEVSMMLGLLSVLAITS---NLLL 356
            ||.....|.||.|:..|.:   |.:|....|.|...:|.::.:...:..|::..|:::   .||.
Yeast     2 KSTLSLTLCVISLLLTLFL---AALDIVIVVTLYDTIGIKFHDFGNIGWLVTGYALSNAVFMLLW 63

  Fly   357 GYIINIVGAKWSIRLGLLLLLLQLFFFGFGTHHWMYWLSSILAALATIIPAANNAVASIYAS--- 418
            |.:..|:|.|       ..|::.:..|..|:     .:|::..::||:|  :...||....|   
Yeast    64 GRLAEILGTK-------ECLMISVIVFEIGS-----LISALSNSMATLI--SGRVVAGFGGSGIE 114

  Fly   419 ------------PDNRGAVLGIISGIECLSEGVGPAFFGVLFFIFQDDSKNKVNSPISMP---FV 468
                        .::||.::..::....::||||| |.|..|           |..:|..   ::
Yeast   115 SLAFVVGTSIVRENHRGIMITALAISYVIAEGVGP-FIGGAF-----------NEHLSWRWCFYI 167

  Fly   469 ISAIGVFVAIVL 480
            ...||.|..|:|
Yeast   168 NLPIGAFAFIIL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18281NP_649236.1 MFS 25..485 CDD:119392 47/207 (23%)
MFS_1 30..441 CDD:284993 35/163 (21%)
SGE1NP_015524.1 MFS_Azr1_MDR_like 24..531 CDD:341045 39/182 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341883
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.