Sequence 1: | NP_649236.1 | Gene: | CG18281 / 40274 | FlyBaseID: | FBgn0037003 | Length: | 542 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_015524.1 | Gene: | SGE1 / 856327 | SGDID: | S000006402 | Length: | 543 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 207 | Identity: | 47/207 - (22%) |
---|---|---|---|
Similarity: | 85/207 - (41%) | Gaps: | 50/207 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 295 KSRKDKNLLVIYLITFLSIWPFAGVDSTAPVYLKTNMGFEYEEVSMMLGLLSVLAITS---NLLL 356
Fly 357 GYIINIVGAKWSIRLGLLLLLLQLFFFGFGTHHWMYWLSSILAALATIIPAANNAVASIYAS--- 418
Fly 419 ------------PDNRGAVLGIISGIECLSEGVGPAFFGVLFFIFQDDSKNKVNSPISMP---FV 468
Fly 469 ISAIGVFVAIVL 480 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18281 | NP_649236.1 | MFS | 25..485 | CDD:119392 | 47/207 (23%) |
MFS_1 | 30..441 | CDD:284993 | 35/163 (21%) | ||
SGE1 | NP_015524.1 | MFS_Azr1_MDR_like | 24..531 | CDD:341045 | 39/182 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C157341883 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |