DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18281 and ATR1

DIOPT Version :9

Sequence 1:NP_649236.1 Gene:CG18281 / 40274 FlyBaseID:FBgn0037003 Length:542 Species:Drosophila melanogaster
Sequence 2:NP_013591.1 Gene:ATR1 / 854924 SGDID:S000004584 Length:542 Species:Saccharomyces cerevisiae


Alignment Length:356 Identity:82/356 - (23%)
Similarity:132/356 - (37%) Gaps:113/356 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 VPESLVLKEKNNMLDEESDNKMEDINPKERK---------------EILNREEKLNNHVSANKSN 246
            :.|||.........||..|:..:..||...|               ::||:.             
Yeast    33 IGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMISQLLNQA------------- 84

  Fly   247 HGTSQNLVTNKELGQQFNKEENLQNDLTEKEKIDNGS--LNSSDLWEV--LRKSRKDKNLLVIYL 307
             ||:|.|.....|...|..|.|.::.|.....:.:||  |.|..|.::  |:|.     |||.|:
Yeast    85 -GTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKM-----LLVGYV 143

  Fly   308 ITFL-----SIWPFAGVDSTAPVYLKTNMGFEYEEVSMMLGLLSVLAITSNLLLG------YIIN 361
            :..:     .|..::|.|:    :...:..|:...::.:|.  :||.|..|:.:|      .:|:
Yeast   144 LVIIWSLICGITKYSGSDT----FFIISRAFQGLGIAFVLP--NVLGIIGNIYVGGTFRKNIVIS 202

  Fly   362 IVGAKWSI--RLGLLLLLLQLFFFG-FGTHH-----WMYWLSSILAALATIIPAANNAVASIYAS 418
            .|||...|  .||.|       |.| .||..     |.::..||.|.:        |.|.||||.
Yeast   203 FVGAMAPIGATLGCL-------FAGLIGTEDPKQWPWAFYAYSIAAFI--------NFVLSIYAI 252

  Fly   419 P------------DNRGAVLGIISGIECLSEGVGPAFFGVLFFIFQDDSKNKVNSPIS---MPFV 468
            |            |..|:|||:|..|             :|.|::.       .:|||   ..::
Yeast   253 PSTIPTNIHHFSMDWIGSVLGVIGLI-------------LLNFVWN-------QAPISGWNQAYI 297

  Fly   469 ISAIGVFVAIVLTGFIKKETVEKAPLIYKII 499
            |..:.:.|..::...|.:....|.||:.:.:
Yeast   298 IVILIISVIFLVVFIIYEIRFAKTPLLPRAV 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18281NP_649236.1 MFS 25..485 CDD:119392 78/340 (23%)
MFS_1 30..441 CDD:284993 71/293 (24%)
ATR1NP_013591.1 MFS_Amf1_MDR_like 73..517 CDD:341029 73/316 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341865
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.