DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18281 and SLC46A2

DIOPT Version :9

Sequence 1:NP_649236.1 Gene:CG18281 / 40274 FlyBaseID:FBgn0037003 Length:542 Species:Drosophila melanogaster
Sequence 2:NP_149040.3 Gene:SLC46A2 / 57864 HGNCID:16055 Length:475 Species:Homo sapiens


Alignment Length:418 Identity:76/418 - (18%)
Similarity:138/418 - (33%) Gaps:139/418 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LSGSFGNRVLLVDGLVYGVRGILGFVTTPVMGAISDFHGRKVVMLLAVATTYAPIPFMMLKSWWF 114
            |:|.||.......|::             .:|::....||:.|.|:.:.                
Human   142 LNGLFGGFSAFWSGVM-------------ALGSLGSSEGRRSVRLILID---------------- 177

  Fly   115 FAILTVSSICGSTYSSSLAYVADTTTVENRSKGYGIVAASFGAGIAFSPSLGNYLMKSYGSASVI 179
             .:|.::..|||..|..|               :..:|...|.|:..:..       |...||..
Human   178 -LMLGLAGFCGSMASGHL---------------FKQMAGHSGQGLILTAC-------SVSCASFA 219

  Fly   180 LIAAITGLINIMFIIFAVPESLVLKEKNNM--LDEESD--NKMEDINPKERKEILNREEKLNNHV 240
            |:.::        ::..|||| |.|....:  :|..|.  .....::|.:    |:::..:.:..
Human   220 LLYSL--------LVLKVPES-VAKPSQELPAVDTVSGTVGTYRTLDPDQ----LDQQYAVGHPP 271

  Fly   241 SANKSN-HGTSQNL----------------------VTNKELGQQFNKEENLQNDLTEKEKIDNG 282
            |..|:. |.|:..|                      |..:.||  :|:.:           :..|
Human   272 SPGKAKPHKTTIALLFVGAIIYDLAVVGTVDVIPLFVLREPLG--WNQVQ-----------VGYG 323

  Fly   283 -----SLNSSDLWEVLRKSR--KDKNLLVIYLITFLSIWPFAGVDSTAPVYLKTNMGFEYEEVSM 340
                 ::..:....||..||  :|..:::|.:::|       |..:....::|....|......|
Human   324 MAAGYTIFITSFLGVLVFSRCFRDTTMIMIGMVSF-------GSGALLLAFVKETYMFYIARAVM 381

  Fly   341 MLGLLSVLAITSNL--------------LLGYIINIVGAKWSIRLGLLLLLLQLFFFGFGTHHWM 391
            :..|:.|..|.|.:              :|...:.:.|...|.....:..|....|.|.     .
Human   382 LFALIPVTTIRSAMSKLIKGSSYGKVFVILQLSLALTGVVTSTLYNKIYQLTMDMFVGS-----C 441

  Fly   392 YWLSSILAALATIIPAANNAVASIYASP 419
            :.|||.|:.|| |||.:..|...:..||
Human   442 FALSSFLSFLA-IIPISIVAYKQVPLSP 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18281NP_649236.1 MFS 25..485 CDD:119392 76/418 (18%)
MFS_1 30..441 CDD:284993 76/418 (18%)
SLC46A2NP_149040.3 MFS_1 84..421 CDD:284993 60/363 (17%)
MFS <282..453 CDD:304372 33/196 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.