DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-39 and YMR090W

DIOPT Version :9

Sequence 1:NP_001262116.1 Gene:ND-39 / 40272 FlyBaseID:FBgn0037001 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_013808.1 Gene:YMR090W / 855115 SGDID:S000004696 Length:227 Species:Saccharomyces cerevisiae


Alignment Length:228 Identity:54/228 - (23%)
Similarity:98/228 - (42%) Gaps:48/228 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 VFGATGFVGRYVCNKLGKSGTQMILPYRGDDSDVIRLKVTGDLGQVLFHFYN-------LED--- 122
            |.||:|.|||.:.|:|           :.:||....|.:.....||.: |.|       |.|   
Yeast     8 VVGASGKVGRLLINQL-----------KANDSFSTPLAIVRTQDQVNY-FKNEVGVDASLTDIEN 60

  Fly   123 --PASIRDAVKHSNVVI---NLVGRDFETKNFKFKDVHVNGAERIARIAREAGVERLIHLSSLNV 182
              .:.|.||:|..:.|:   ...|:..|    :...|.::|..::.....:||::|.:.:|:|  
Yeast    61 ASVSEITDAIKAYDAVVFSAGAGGKGME----RIFTVDLDGCIKVVEACEKAGIKRFVVVSAL-- 119

  Fly   183 EANPKDLY--VKGGSEWLKSKYEGELRVRDAFPNATIIRPADIYGSEDRFLRYYAHIWRRQFRSM 245
            :|..:|.:  :||..|:..:|...:..||::..:.||::|..:..::...|            ..
Yeast   120 KAEDRDFWYNIKGLREYYIAKRSADREVRNSNLDYTILQPGSLELNKGTGL------------LQ 172

  Fly   246 PLWHKGEK-TVKQPVYVSDVAQAIINAAKDPDS 277
            ||....|| :|...:...|||..|:.:...|::
Yeast   173 PLDKLEEKASVNYSINREDVASFIVESLLHPNA 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-39NP_001262116.1 NDUFA9_like_SDR_a 64..354 CDD:187579 54/228 (24%)
Epimerase 66..282 CDD:279681 54/228 (24%)
YMR090WNP_013808.1 SDR_a5 5..217 CDD:187554 54/228 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0702
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.