DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-39 and HCF173

DIOPT Version :10

Sequence 1:NP_649234.1 Gene:ND-39 / 40272 FlyBaseID:FBgn0037001 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001323375.1 Gene:HCF173 / 838243 AraportID:AT1G16720 Length:631 Species:Arabidopsis thaliana


Alignment Length:87 Identity:22/87 - (25%)
Similarity:39/87 - (44%) Gaps:13/87 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 LLAFIVCTTSVAFTSLVITAIPTLVAMGRAATSFAK--LADTARKEL---------PSTLAAVRL 160
            :|:|::  ..|.|..:||.|:.::|.:..|..:|..  :..|....|         |:|:|...|
plant     1 MLSFLI--PVVQFFQVVIAAVASVVFLVFAGITFGASIVGLTIATPLFVIFSPILVPATIATTFL 63

  Fly   161 SGMEISDLTLELSDLRLSLKLF 182
            .|...:.:.|.::...|.|.||
plant    64 VGGATAAVALGVTAFALILWLF 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-39NP_649234.1 NDUFA9_like_SDR_a 64..354 CDD:187579 22/87 (25%)
HCF173NP_001323375.1 Rossmann-fold NAD(P)(+)-binding proteins 164..>259 CDD:473865
CIA30 285..420 CDD:473944
Rossmann-fold NAD(P)(+)-binding proteins <469..593 CDD:473865
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.