DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-39 and Nmral1

DIOPT Version :9

Sequence 1:NP_001262116.1 Gene:ND-39 / 40272 FlyBaseID:FBgn0037001 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_080669.1 Gene:Nmral1 / 67824 MGIID:1915074 Length:309 Species:Mus musculus


Alignment Length:237 Identity:46/237 - (19%)
Similarity:86/237 - (36%) Gaps:52/237 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 VATVFGATGFVGRYVCNKLGKSGTQMI--------------LPYRGDDSDVIRLKVTGDLGQVLF 115
            :..||||||..|..|...|.:.||..|              |..:|  ::|:|    ||      
Mouse     6 LVVVFGATGAQGGSVARALLEDGTFRIRVVTRNPEQRAAKELKQQG--AEVVR----GD------ 58

  Fly   116 HFYNLEDPASIRDAV--KHSNVVI----NLVGRDFETKNFKFKDVHVNGAERIARIAREAGVERL 174
                .:|.||:..|:  .|:..::    ....:|.|.:.....|......:.:|.:|:..|:..:
Mouse    59 ----QDDAASMELALAGAHATFIVTNYWETCSQDREVQQPHQWDQVFKQGKLLADLAKRLGLHYV 119

  Fly   175 IHLSSLNVEANPKDLYVKGGSEWLKSKYEGELRVRDAF-----PNATIIRPADIYGSEDRFLRYY 234
            ::....|:..........|       .::|:..|.:.|     |..::..|.........||...
Mouse   120 VYSGLENIRKLTAGKLAAG-------HFDGKGEVEEYFRDIGVPMTSVRLPCYFENLLSYFLPQK 177

  Fly   235 AHIWRRQFRSMPLWHKGEKTVKQPVYVSDVAQAIINAAKDPD 276
            |...:.....:|:   |:..: ..:.|||:...:::..|.|:
Mouse   178 AADGKSFLLDLPM---GDVPM-DGMSVSDLGPVVLSLLKKPE 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-39NP_001262116.1 NDUFA9_like_SDR_a 64..354 CDD:187579 46/237 (19%)
Epimerase 66..282 CDD:279681 46/236 (19%)
Nmral1NP_080669.1 YbjT 5..>216 CDD:223774 46/237 (19%)
NmrA_like_SDR_a 7..248 CDD:187561 46/236 (19%)
Interaction with ASS1. /evidence=ECO:0000250 163..199 6/39 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0702
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.