Sequence 1: | NP_001262116.1 | Gene: | ND-39 / 40272 | FlyBaseID: | FBgn0037001 | Length: | 416 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571756.1 | Gene: | htatip2 / 64605 | ZFINID: | ZDB-GENE-001219-1 | Length: | 236 | Species: | Danio rerio |
Alignment Length: | 257 | Identity: | 54/257 - (21%) |
---|---|---|---|
Similarity: | 89/257 - (34%) | Gaps: | 91/257 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 94 YRGDDSDVIRLKVTGDLGQVLFHFYNLEDPASIRDAVKHSNVV--INLVGR-------------- 142
Fly 143 ----DFE-----TKNFKFKDVHV---------NGAE-----------RIARIAREAGVERLIHL- 177
Fly 178 SSLNVEANPKDLYVKGGSEWLKSKYEGELRVRD-AFPNATIIRPADIY--GSEDRFLRYYAHIWR 239
Fly 240 RQFRSMPLWHKGEKTV---KQPVYVSDVAQAI-INAAKDPDSAGRIYQ--------AVGPKR 289 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ND-39 | NP_001262116.1 | NDUFA9_like_SDR_a | 64..354 | CDD:187579 | 54/257 (21%) |
Epimerase | 66..282 | CDD:279681 | 50/240 (21%) | ||
htatip2 | NP_571756.1 | CC3_like_SDR_a | 15..227 | CDD:187560 | 49/241 (20%) |
YbjT | 19..>207 | CDD:223774 | 45/217 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0702 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |