DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-39 and htatip2

DIOPT Version :9

Sequence 1:NP_001262116.1 Gene:ND-39 / 40272 FlyBaseID:FBgn0037001 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_571756.1 Gene:htatip2 / 64605 ZFINID:ZDB-GENE-001219-1 Length:236 Species:Danio rerio


Alignment Length:257 Identity:54/257 - (21%)
Similarity:89/257 - (34%) Gaps:91/257 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 YRGDDSDVIRLKVTGDLGQVLFHFYNLEDPASIRDAVKHSNVV--INLVGR-------------- 142
            ||..:.....|..:|:.|:.|           :::.|:. |:.  |.|:||              
Zfish    10 YRQKNKTCFILGGSGETGKAL-----------LKELVER-NIFSRITLIGRRQLTFEDKAYENLV 62

  Fly   143 ----DFE-----TKNFKFKDVHV---------NGAE-----------RIARIAREAGVERLIHL- 177
                |||     .:.|:..||..         .|||           :.|.:|:..|... .|| 
Zfish    63 QKVVDFEKLDEYAEAFQGHDVGYCCLGTTRAKAGAEGFVRVDHDYVLKSAELAKAGGCSH-FHLE 126

  Fly   178 SSLNVEANPKDLYVKGGSEWLKSKYEGELRVRD-AFPNATIIRPADIY--GSEDRFLRYYAHIWR 239
            ||...:.....||       ||:|.:.|..:.: .|...::.|||.:.  ..|.|...:.|   |
Zfish   127 SSKGADKTSSFLY-------LKTKGQVEAEIEELGFERLSVYRPAVLLVDRQESRPSEWMA---R 181

  Fly   240 RQFRSMPLWHKGEKTV---KQPVYVSDVAQAI-INAAKDPDSAGRIYQ--------AVGPKR 289
            :.|.:.       .||   ...:.::.|.:|: :|..||.:....|.:        .||.|:
Zfish   182 KFFGAF-------STVFPTAMSIPITSVVRAMAVNTLKDGEQKVEILENKAIHTLGKVGEKK 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-39NP_001262116.1 NDUFA9_like_SDR_a 64..354 CDD:187579 54/257 (21%)
Epimerase 66..282 CDD:279681 50/240 (21%)
htatip2NP_571756.1 CC3_like_SDR_a 15..227 CDD:187560 49/241 (20%)
YbjT 19..>207 CDD:223774 45/217 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0702
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.