DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-39 and Htatip2

DIOPT Version :9

Sequence 1:NP_001262116.1 Gene:ND-39 / 40272 FlyBaseID:FBgn0037001 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_006229311.1 Gene:Htatip2 / 292935 RGDID:1309941 Length:275 Species:Rattus norvegicus


Alignment Length:314 Identity:70/314 - (22%)
Similarity:106/314 - (33%) Gaps:109/314 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAIVLTRNLQLAKHHGSGVVGVLCLRGYSAAAAPPEDGPRPLKTTNPAAMKRGTGGRSSFNGIV 65
            :||:|.:..|......|||            ||....|....||......|:    .:|.|    
  Rat    11 VAALVASMLLLQRGDEGSG------------AAPSMADKETLLKLREDFKMQ----NKSVF---- 55

  Fly    66 ATVFGATGFVGRYVCNKLGKSGTQMILPYRGDDSDVIRLKVTGDLGQVLFHFYNL--------ED 122
              :.||:|..|:.:..::                          |||.||....|        |:
  Rat    56 --ILGASGETGKVLLKEI--------------------------LGQNLFSKVTLIGRRKLTFEE 92

  Fly   123 PASIRDAVKHSNVVINLVGRDFETKN-----FKFKDV------------HVNGAERI-------- 162
            .|       ::||...:|  |||..:     |:..||            ..:|..|:        
  Rat    93 EA-------YNNVNQEVV--DFEKLDEYAPAFQGHDVGFCCLGTTRRKAGADGFVRVDRDYVLKS 148

  Fly   163 ARIAREAGVERLIHLSSLNVEANPKDLYVKGGSEWLKSKYEGELRVRD-AFPNATIIRPADIY-- 224
            |.:|:..|.:....|||...:.:...||       |:.|.|.|.:|.: .|...::.||..:.  
  Rat   149 AELAKAGGCKHFNLLSSRGADKSSSFLY-------LQVKGEVEAKVEELKFDRLSVFRPGVLLCD 206

  Fly   225 GSEDRFLRYYAHIWRRQFRSMP-LWHKGEKTVKQPVYVSDVAQAIINAAKDPDS 277
            ..|.|...:.|   |:.|.|:| .|..|     ..|.|..|.:|::|....|.|
  Rat   207 RQESRPGEWLA---RKFFGSLPDSWASG-----YAVPVVTVVRAMLNNLVSPGS 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-39NP_001262116.1 NDUFA9_like_SDR_a 64..354 CDD:187579 55/251 (22%)
Epimerase 66..282 CDD:279681 55/249 (22%)
Htatip2XP_006229311.1 CC3_like_SDR_a 52..264 CDD:187560 57/257 (22%)
YbjT 54..>226 CDD:223774 46/222 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0702
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.