DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-39 and HTATIP2

DIOPT Version :9

Sequence 1:NP_001262116.1 Gene:ND-39 / 40272 FlyBaseID:FBgn0037001 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001091990.1 Gene:HTATIP2 / 10553 HGNCID:16637 Length:276 Species:Homo sapiens


Alignment Length:284 Identity:66/284 - (23%)
Similarity:101/284 - (35%) Gaps:78/284 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SAAAA-------------PPEDGPRPLKTTNPAAMKRGTGGRSSFNGIVATVF--GATGFVGRYV 79
            |||||             .|..|..|......|..|.    |..|.....:||  ||:|..||.:
Human     8 SAAAAAALAAALLLLRREDPGPGAGPSMAETEALSKL----REDFRMQNKSVFILGASGETGRVL 68

  Fly    80 CNKLGKSGTQMILPYRGDDSDVIRLKVTGD------LGQVLFHFYNLEDPASIRDAVKHSNVVIN 138
            ..::.:.|....:...|      |.|:|.|      :.|.:..|..|:|.||   |.:..:|...
Human    69 LKEILEQGLFSKVTLIG------RRKLTFDEEAYKNVNQEVVDFEKLDDYAS---AFQGHDVGFC 124

  Fly   139 LVG---------------RDFETKNFKFKDVHVNGAERIARIAREAGVERLIHLSSLNVEANPKD 188
            .:|               ||:..|:              |.:|:..|.:....|||...:.:...
Human   125 CLGTTRGKAGAEGFVRVDRDYVLKS--------------AELAKAGGCKHFNLLSSKGADKSSNF 175

  Fly   189 LYVKGGSEWLKSKYEGELRVRD-AFPNATIIRPADIYGSEDRFLRYYAHIWRRQFRSMP-LWHKG 251
            ||       |:.|.|.|.:|.: .|...::.||. :...:.:..|....:.|:.|.|:| .|..|
Human   176 LY-------LQVKGEVEAKVEELKFDRYSVFRPG-VLLCDRQESRPGEWLVRKFFGSLPDSWASG 232

  Fly   252 EKTVKQPVYVSDVAQAIINAAKDP 275
            ..     |.|..|.:|::|....|
Human   233 HS-----VPVVTVVRAMLNNVVRP 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-39NP_001262116.1 NDUFA9_like_SDR_a 64..354 CDD:187579 54/237 (23%)
Epimerase 66..282 CDD:279681 54/235 (23%)
HTATIP2NP_001091990.1 CC3_like_SDR_a 53..265 CDD:187560 54/235 (23%)
YbjT 55..>205 CDD:223774 41/180 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0702
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.