DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZnT77C and MSC2

DIOPT Version :9

Sequence 1:NP_649233.2 Gene:ZnT77C / 40271 FlyBaseID:FBgn0037000 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_010491.4 Gene:MSC2 / 851786 SGDID:S000002613 Length:724 Species:Saccharomyces cerevisiae


Alignment Length:411 Identity:72/411 - (17%)
Similarity:138/411 - (33%) Gaps:143/411 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LYTVLVLSICYFVLQLILSHLTHGLTLLMASHHML--CNIFALG--GCIITIKHSKQAPEARNPS 74
            :::.|:|:..:..:||:.|..:..|.||..|.||.  |....||  ..::|.|            
Yeast   388 IFSFLLLNTAFMFVQLLYSFRSKSLGLLSDSLHMALDCTSLLLGLIAGVLTKK------------ 440

  Fly    75 PALTKINGSGVAISLADTDAQTRAKRECREQKLRNTFGWARIDILTMLIVFIILASLSFSLVVEA 139
            ||..|.                             .||...:..|......::|..:...:.|||
Yeast   441 PASDKF-----------------------------PFGLNYLGTLAGFTNGVLLLGIVCGIFVEA 476

  Fly   140 LQTLVHIDHQDTMHLPIPVMMLGFIGLILNGLTYLLIGGYTLHQGSFLHLTPGGNVVLERPMSSN 204
            ::.:.:..|   :|....::::..:||::|     |:|.:....|:..|   ||           
Yeast   477 IERIFNPIH---LHATNELLVVATLGLLVN-----LVGLFAFDHGAHDH---GG----------- 519

  Fly   205 LDLSLTPMQRHLSKSRNDRQLREELETEVGSVYFATKRQGAVEMLRDVSSTIFVIVCAAIVYVAE 269
                        :.:.|.:.:                   .:.:|.|...::.|::...::.:. 
Yeast   520 ------------TDNENMKGI-------------------FLHILADTLGSVGVVISTLLIKLT- 552

  Fly   270 DEQHTAKFIDPVLSIFSCVLLVTLSYPYMKE-SCLILLQTIPGSIDLEIFERTLVTKFPEIISYH 333
               |...| ||:.|:....|::..:.|.:|. |..|||:......:|.......::..|.|..|.
Yeast   553 ---HWPIF-DPIASLLIGSLILLSALPLLKSTSANILLRLDDKKHNLVKSALNQISTTPGITGYT 613

  Fly   334 DLHIWQLA--------AHRY------------------------VATIHIQF---QNPKLYLKII 363
            ....|...        ||.:                        |..||:|:   :|..:..|.:
Yeast   614 TPRFWPTESGSSGHSHAHTHSHAENHSHEHHHDQKNGSQEHPSLVGYIHVQYVDGENSTIIKKRV 678

  Fly   364 EQVRSYFHDQGIGA-VTIQPE 383
            |::   |.:..|.| |.::|:
Yeast   679 EKI---FENVSIKAWVQVEPQ 696

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZnT77CNP_649233.2 CzcD 14..384 CDD:224151 72/411 (18%)
Cation_efflux 25..306 CDD:279834 49/285 (17%)
MSC2NP_010491.4 CzcD 378..673 CDD:224151 65/383 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1230
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.