DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZnT77C and SLC30A6

DIOPT Version :9

Sequence 1:NP_649233.2 Gene:ZnT77C / 40271 FlyBaseID:FBgn0037000 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_001180442.1 Gene:SLC30A6 / 55676 HGNCID:19305 Length:501 Species:Homo sapiens


Alignment Length:281 Identity:52/281 - (18%)
Similarity:107/281 - (38%) Gaps:52/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 TFGWARIDILTMLIVFIILASLSFSLVVEALQTLVHIDHQDTMHLPIPVMMLG-FIGLILNGLTY 173
            :||:.|:::|. :....:||.|....:::  ::......|..:|  ...:::| |:.|..|..|.
Human   133 SFGFERLEVLA-VFASTVLAQLGALFILK--ESAERFLEQPEIH--TGRLLVGTFVALCFNLFTM 192

  Fly   174 LLIGGYTLHQGSFLHLTPGGNVVLERPMSSNLDLSLTPMQRHLSKSRNDRQLREELETEVGSVYF 238
            |     ::....|.:::...:....:...::|..||..:...||                 |::.
Human   193 L-----SIRNKPFAYVSEAASTSWLQEHVADLSRSLCGIIPGLS-----------------SIFL 235

  Fly   239 ATKRQGAVEMLRDVSSTIFVIVCAAIV----YVAEDEQHTAKFIDPVLSIFSCVLLVTLSYPYMK 299
            .....   .:|.|::....:.:...::    |.|.|   ||..|...|..|..:      ||...
Human   236 PRMNP---FVLIDLAGAFALCITYMLIEINNYFAVD---TASAIAIALMTFGTM------YPMSV 288

  Fly   300 ESCLILLQTIP----GSIDLEIFERTLVTKFPEIISYHDLHIWQLAAHRYVATIHIQFQNPKLYL 360
            .|..:||||.|    |.:|..|.|   |:....::...:.|.|.|.......::|::.:......
Human   289 YSGKVLLQTTPPHVIGQLDKLIRE---VSTLDGVLEVRNEHFWTLGFGSLAGSVHVRIRRDANEQ 350

  Fly   361 KIIEQVRSYFHDQGIGAVTIQ 381
            .::..|.:..:.. :..:|:|
Human   351 MVLAHVTNRLYTL-VSTLTVQ 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZnT77CNP_649233.2 CzcD 14..384 CDD:224151 52/281 (19%)
Cation_efflux 25..306 CDD:279834 35/200 (18%)
SLC30A6NP_001180442.1 CzcD <113..371 CDD:224151 52/281 (19%)
Cation_efflux 113..295 CDD:279834 35/200 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1230
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.