DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZnT77C and Slc30a8

DIOPT Version :9

Sequence 1:NP_649233.2 Gene:ZnT77C / 40271 FlyBaseID:FBgn0037000 Length:513 Species:Drosophila melanogaster
Sequence 2:XP_008763722.1 Gene:Slc30a8 / 299903 RGDID:1308282 Length:369 Species:Rattus norvegicus


Alignment Length:333 Identity:71/333 - (21%)
Similarity:131/333 - (39%) Gaps:94/333 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SICYF--VLQLILSHLTHGLTLLMASHHMLCNIFALGGCIITIKHSKQAPEARNPSPALTKINGS 83
            :||:|  |.:::..|:...|.:|..:.|:|.::.:....:.::..|.:.|..             
  Rat    79 AICFFFMVAEVVGGHVAGSLAVLTDAAHLLIDLTSFLLSLFSLWLSSRPPSK------------- 130

  Fly    84 GVAISLADTDAQTRAKRECREQKLRNTFGWARIDILTMLIVFIILASLSFSLVVEALQTLVHIDH 148
                                    |.||||.|.:||..|:..:.:..::..||..|.:.|::.|:
  Rat   131 ------------------------RLTFGWYRAEILGALLSVLCIWVVTGVLVYLACERLLYPDY 171

  Fly   149 QDTMHLPIPVMMLGFIGLILNGLTYLLIGGYTLHQGSFLHLTPGGNVVLERPMSSNLDLSLTPMQ 213
            |                               :..|  :.:|..|..|     ::|:.|:|...|
  Rat   172 Q-------------------------------IQAG--IMITVSGCAV-----AANIVLTLILHQ 198

  Fly   214 RHLSKSRNDRQLREELETEVGSVYFATKRQGAVEMLRDVSSTIFVIVCAAIVYVAEDEQHTAKFI 278
            |||..:..|.|..            |:.|...|..|.||..:..|::.|.|:|...|    .|..
  Rat   199 RHLGHNHKDAQAN------------ASVRAAFVHALGDVFQSTSVLISALIIYFKPD----YKMA 247

  Fly   279 DPVLSIFSCVLLVTLSYPYMKESCLILLQTIPGSIDLEIFERTLVTKFPEIISYHDLHIWQLAAH 343
            |||.:..|.||.:..:...:|:..::|::.:|..:.....:..|:| ...:||.|:||||.|..:
  Rat   248 DPVCTFISSVLALASTVMILKDFSILLMEGVPKGLSYNSVKELLLT-VDGVISVHNLHIWSLTVN 311

  Fly   344 RYVATIHI 351
            :.:.::|:
  Rat   312 QVILSVHV 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZnT77CNP_649233.2 CzcD 14..384 CDD:224151 71/333 (21%)
Cation_efflux 25..306 CDD:279834 56/282 (20%)
Slc30a8XP_008763722.1 CDF 83..354 CDD:273544 69/329 (21%)
Cation_efflux 84..274 CDD:279834 55/280 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1230
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D820567at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.