DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZnT77C and Slc30a6

DIOPT Version :9

Sequence 1:NP_649233.2 Gene:ZnT77C / 40271 FlyBaseID:FBgn0037000 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_001239407.1 Gene:Slc30a6 / 210148 MGIID:2386741 Length:465 Species:Mus musculus


Alignment Length:271 Identity:57/271 - (21%)
Similarity:99/271 - (36%) Gaps:61/271 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 TMLIVFIILASLSFSLVVEALQTLVHIDHQDTMHLPIPVMMLGFIGLILNGLTYLLIGGYTL--H 182
            |.|.:|.:.:...|||:.      ..|.:...|..|.||...||     ..|..|.:...|:  .
Mouse    64 TYLTIFDLFSLFFFSLIT------CLISYWVMMRKPSPVYSFGF-----ERLEVLAVFASTVLAQ 117

  Fly   183 QGSFLHLTPGGNVVLERP--------------MSSNLDLSLTPMQR---HLSKSRNDRQLREELE 230
            .|:...|.......||:|              :|.||...|:...:   ::|::.:...|:|   
Mouse   118 LGALFILKESAERFLEQPEIHTGRLLVGTFVALSFNLFTMLSIRNKPFAYVSEAASTSWLQE--- 179

  Fly   231 TEVGSVYFATKRQGAVEMLRDVSSTI------FVIVCAA------IVY-VAEDEQHTAKFIDPVL 282
                  :.|...:....::..:||..      ||::..|      |.| :.|...:.|  :|...
Mouse   180 ------HVADLSRSLCGLIPGLSSIFLPRMNPFVLIDLAGAFALCITYMLIEINNYFA--VDTAS 236

  Fly   283 SIFSCVLLVTLSYPYMKESCLILLQTIP----GSIDLEIFERTLVTKFPEIISYHDLHIWQLAAH 343
            :|...::.....||....|..:||||.|    |.:|..|.|   |:....::...:.|.|.|...
Mouse   237 AIAIALMTFGTMYPMSVYSGKVLLQTTPPHVIGQLDKLIRE---VSTLDGVLEVRNEHFWTLGFG 298

  Fly   344 RYVATIHIQFQ 354
            ....::|::.:
Mouse   299 SLAGSVHVRIR 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZnT77CNP_649233.2 CzcD 14..384 CDD:224151 57/271 (21%)
Cation_efflux 25..306 CDD:279834 43/217 (20%)
Slc30a6NP_001239407.1 Cation_efflux 43..260 CDD:279834 43/217 (20%)
CzcD <83..336 CDD:224151 51/246 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 376..395
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1230
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.