DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZnT77C and SLC30A8

DIOPT Version :9

Sequence 1:NP_649233.2 Gene:ZnT77C / 40271 FlyBaseID:FBgn0037000 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_776250.2 Gene:SLC30A8 / 169026 HGNCID:20303 Length:369 Species:Homo sapiens


Alignment Length:333 Identity:59/333 - (17%)
Similarity:129/333 - (38%) Gaps:94/333 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SIC--YFVLQLILSHLTHGLTLLMASHHMLCNIFALGGCIITIKHSKQAPEARNPSPALTKINGS 83
            :||  :.:.:::..|:...|.::..:.|:|.::.:....:.::..|.:.|..             
Human    79 AICFIFMIAEVVGGHIAGSLAVVTDAAHLLIDLTSFLLSLFSLWLSSKPPSK------------- 130

  Fly    84 GVAISLADTDAQTRAKRECREQKLRNTFGWARIDILTMLIVFIILASLSFSLVVEALQTLVHIDH 148
                                    |.||||.|.:||..|:..:.:..::..||..|.:.|::.|:
Human   131 ------------------------RLTFGWHRAEILGALLSILCIWVVTGVLVYLACERLLYPDY 171

  Fly   149 QDTMHLPIPVMMLGFIGLILNGLTYLLIGGYTLHQGSFLHLTPGGNVVLERPMSSNLDLSLTPMQ 213
            |    :...||:                                  :|....:::|:.|::...|
Human   172 Q----IQATVMI----------------------------------IVSSCAVAANIVLTVVLHQ 198

  Fly   214 RHLSKSRNDRQLREELETEVGSVYFATKRQGAVEMLRDVSSTIFVIVCAAIVYVAEDEQHTAKFI 278
            |.|..:..:.|..            |:.|...|..|.|:..:|.|::.|.|:|...:    .|..
Human   199 RCLGHNHKEVQAN------------ASVRAAFVHALGDLFQSISVLISALIIYFKPE----YKIA 247

  Fly   279 DPVLSIFSCVLLVTLSYPYMKESCLILLQTIPGSIDLEIFERTLVTKFPEIISYHDLHIWQLAAH 343
            ||:.:....:|::..:...:|:..::|::.:|.|::.. ..:.|:.....::|.|.||||.|..:
Human   248 DPICTFIFSILVLASTITILKDFSILLMEGVPKSLNYS-GVKELILAVDGVLSVHSLHIWSLTMN 311

  Fly   344 RYVATIHI 351
            :.:.:.|:
Human   312 QVILSAHV 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZnT77CNP_649233.2 CzcD 14..384 CDD:224151 59/333 (18%)
Cation_efflux 25..306 CDD:279834 45/280 (16%)
SLC30A8NP_776250.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..52
CDF 83..353 CDD:273544 57/329 (17%)
Cation_efflux 83..274 CDD:279834 45/281 (16%)
HXXXXX[HY]NH-motif 197..205 3/7 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1230
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D820567at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.