DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment isoQC and Qpct

DIOPT Version :9

Sequence 1:NP_788550.1 Gene:isoQC / 40270 FlyBaseID:FBgn0036999 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_081731.1 Gene:Qpct / 70536 MGIID:1917786 Length:362 Species:Mus musculus


Alignment Length:296 Identity:144/296 - (48%)
Similarity:193/296 - (65%) Gaps:28/296 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 ILIPRVVGTTNHSIVREYIVQSLRDL--DWDVEVNSFHDHAPIKGKLHFHNIIATLNPNAERYLV 133
            :||.|..|:......|::|:|.::.|  :|.|||::|....|. |...|.|||:||||.|:|:||
Mouse    74 LLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPY-GYRSFSNIISTLNPEAKRHLV 137

  Fly   134 LSCHYDSKYMPGVE---FLGATDSAVPCAMLLNLAQVLQEQLKPLK-----KSKLSLMLLFFDGE 190
            |:|||||||.|..:   |:|||||||||||:|.||:.|.::|..||     |..|||.|:|||||
Mouse   138 LACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDVSGSKPDLSLRLIFFDGE 202

  Fly   191 EAFEEWGPKDSIYGARHLAKKW----HHEG-----KLDRIDMLVLLDLLGAPDPAFYSFFENTES 246
            |||..|.|:||:||:||||:|.    |..|     :||.:|:||||||:||.:|.|.:||..|..
Mouse   203 EAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTR 267

  Fly   247 WYMRIQSVETRLAKLQLLERYASSGVAQRDPTRYFQSQAMRSSFIEDDHIPFLRRNVPILHLIPV 311
            |:.|:|::|..|.:|.||:.::..       .:|||:... .:.|:||||||||:.||:||||..
Mouse   268 WFNRLQAIEKELYELGLLKDHSLE-------RKYFQNFGY-GNIIQDDHIPFLRKGVPVLHLIAS 324

  Fly   312 PFPSVWHTPDDNASVIDYATTDNLALIIRLFALEYL 347
            |||.||||.|||...:..:|.|||..||::|.||||
Mouse   325 PFPEVWHTMDDNEENLHASTIDNLNKIIQVFVLEYL 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
isoQCNP_788550.1 M28_QC_like 56..346 CDD:193501 141/293 (48%)
QpctNP_081731.1 M28_QC_like 60..359 CDD:193501 141/293 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 230 1.000 Domainoid score I2442
eggNOG 1 0.900 - - E1_KOG3946
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8238
Inparanoid 1 1.050 257 1.000 Inparanoid score I3132
Isobase 1 0.950 - 0.861353 Normalized mean entropy S1680
OMA 1 1.010 - - QHG55920
OrthoDB 1 1.010 - - D1257754at2759
OrthoFinder 1 1.000 - - FOG0001509
OrthoInspector 1 1.000 - - mtm8891
orthoMCL 1 0.900 - - OOG6_102560
Panther 1 1.100 - - O PTHR12283
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2349
SonicParanoid 1 1.000 - - X1074
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.820

Return to query results.
Submit another query.