DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment isoQC and Qpctl

DIOPT Version :9

Sequence 1:NP_788550.1 Gene:isoQC / 40270 FlyBaseID:FBgn0036999 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_080387.2 Gene:Qpctl / 67369 MGIID:1914619 Length:383 Species:Mus musculus


Alignment Length:384 Identity:157/384 - (40%)
Similarity:220/384 - (57%) Gaps:50/384 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RLLLRNYSLME----AVKRLLPRPR-----KKIYNLGACFELVDIPKISYNP--SELSEPRFLE- 54
            |..|.:..||:    :.:|||||.:     .....:|..|.:|   ..|::|  .|:|..|.|. 
Mouse    10 RQRLEDRGLMKPPSLSKRRLLPRVQFLPLLLLALAMGLAFYIV---WNSWHPGVEEMSRSRDLRV 71

  Fly    55 --YSNLSD-KLHL-----------REAIDKILIPRVVGTTNHSIVREYIVQSLRDLD--WDVEVN 103
              ..:||: ||.|           ...:..:||.|..|::.:..||:::..:|:.|.  |.||::
Mouse    72 PLIGSLSEAKLRLVVGQLDPQRLWGTFLRPLLIVRPPGSSGNLQVRKFLEATLQSLSAGWHVELD 136

  Fly   104 SFHDHAPIKGKLHFHNIIATLNPNAERYLVLSCHYDSKYM-PGV-EFLGATDSAVPCAMLLNLAQ 166
            .|....|: |.|.|.|::|||:|.|.|:|.|:||||||:. ||: .|:||||||||||:||.|.|
Mouse   137 PFTASTPL-GPLDFGNVVATLDPGAARHLTLACHYDSKFFPPGLPPFVGATDSAVPCALLLELVQ 200

  Fly   167 VLQEQLKPLKK--SKLSLMLLFFDGEEAFEEWGPKDSIYGARHLAKKW----HHEG--KLDRIDM 223
            .|...|..:|:  :.::|.|||.|||||.:|||||||:||:||||:..    |..|  ::..|::
Mouse   201 ALDAMLSRIKQQAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQIMESIPHSPGPTRIQAIEL 265

  Fly   224 LVLLDLLGAPDPAFYSFFENTESWYMRIQSVETRLAKLQLLERYASSGVAQRDPTRYFQSQAMRS 288
            .||||||||..|.|:|.|..|..|:.|::|:|.||.:|.||:.:...       ..|||......
Mouse   266 FVLLDLLGASSPIFFSHFPRTARWFQRLRSIEKRLHRLNLLQSHPQE-------VMYFQPGEPPG 323

  Fly   289 SFIEDDHIPFLRRNVPILHLIPVPFPSVWHTPDDNASVIDYATTDNLALIIRLFALEYL 347
            . :||||||||||.||:||||..|||:|||||.|..:.:...|..||:.|:.:|..|||
Mouse   324 P-VEDDHIPFLRRGVPVLHLIATPFPAVWHTPADTEANLHPPTVHNLSRILAVFLAEYL 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
isoQCNP_788550.1 M28_QC_like 56..346 CDD:193501 136/313 (43%)
QpctlNP_080387.2 M28_QC_like 80..380 CDD:193501 134/308 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 230 1.000 Domainoid score I2442
eggNOG 1 0.900 - - E1_KOG3946
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 257 1.000 Inparanoid score I3132
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55920
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001509
OrthoInspector 1 1.000 - - mtm8891
orthoMCL 1 0.900 - - OOG6_102560
Panther 1 1.100 - - LDO PTHR12283
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2349
SonicParanoid 1 1.000 - - X1074
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.