DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment isoQC and qpct

DIOPT Version :9

Sequence 1:NP_788550.1 Gene:isoQC / 40270 FlyBaseID:FBgn0036999 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001017245.1 Gene:qpct / 549999 XenbaseID:XB-GENE-953343 Length:359 Species:Xenopus tropicalis


Alignment Length:350 Identity:147/350 - (42%)
Similarity:203/350 - (57%) Gaps:43/350 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FELVDIPKISYNPSELS----------EPRFLEYSNLSDKLHLREA-------IDKILIPRVVGT 79
            |.|:.:..|..|...:|          .|..|..|::...|...:.       :..:|..|..|:
 Frog    17 FYLLSVCVIHTNGQSVSSRWTTEKNSHRPVVLHTSDIQKVLSQTDVGQMFQTDLKPMLTERYAGS 81

  Fly    80 TNHSIVREYIVQSLRDLD--WDVEVNSFHDHAPIKGKLHFHNIIATLNPNAERYLVLSCHYDSKY 142
            ..:..||::|.|.|:.|.  |..|.::|....|. |.:.|.|||:||||:|:|:|||:|||||||
 Frog    82 PGNYAVRQHIKQRLQSLQAGWVTEEDTFEAPTPY-GYVTFSNIISTLNPSAKRHLVLACHYDSKY 145

  Fly   143 M----PGVEFLGATDSAVPCAMLLNLAQVLQEQLKPLKKSK--LSLMLLFFDGEEAFEEWGPKDS 201
            .    .|..|:||.|:||||||:|.||:.|...||....||  |||.|:||||||||:.|...||
 Frog   146 FSPQWDGRVFVGAIDAAVPCAMMLELARALDSSLKKKLNSKLDLSLQLIFFDGEEAFQRWSSYDS 210

  Fly   202 IYGARHLAKKW---------HHEGKLDRIDMLVLLDLLGAPDPAFYSFFENTESWYMRIQSVETR 257
            :||::|||:|.         .:..:|..||:.:||||:|..:|.|.::|:||..|:.|:||:|.|
 Frog   211 LYGSKHLAQKMETISHPPNAENTNQLHGIDLFILLDLIGTANPVFPNYFQNTARWFNRLQSIERR 275

  Fly   258 LAKLQLLERYASSGVAQRDPTRYFQSQAMRSSFIEDDHIPFLRRNVPILHLIPVPFPSVWHTPDD 322
            |..|.||:.:.|.       .:|||| ..|:..:.|||:|||:|.||||||||.|||.||||.:|
 Frog   276 LHGLNLLKNHPSE-------VQYFQS-GFRARPVLDDHVPFLQRGVPILHLIPSPFPEVWHTMED 332

  Fly   323 NASVIDYATTDNLALIIRLFALEYL 347
            |...:|.||.:||..|:::|.||||
 Frog   333 NEENLDSATIENLNKILQVFVLEYL 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
isoQCNP_788550.1 M28_QC_like 56..346 CDD:193501 137/313 (44%)
qpctNP_001017245.1 M28_QC_like 51..356 CDD:349876 137/313 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 226 1.000 Domainoid score I2465
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8238
Inparanoid 1 1.050 250 1.000 Inparanoid score I3151
OMA 1 1.010 - - QHG55920
OrthoDB 1 1.010 - - D1257754at2759
OrthoFinder 1 1.000 - - FOG0001509
OrthoInspector 1 1.000 - - mtm9550
Panther 1 1.100 - - O PTHR12283
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2349
SonicParanoid 1 1.000 - - X1074
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.