DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment isoQC and QPCTL

DIOPT Version :9

Sequence 1:NP_788550.1 Gene:isoQC / 40270 FlyBaseID:FBgn0036999 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_060129.2 Gene:QPCTL / 54814 HGNCID:25952 Length:382 Species:Homo sapiens


Alignment Length:384 Identity:159/384 - (41%)
Similarity:212/384 - (55%) Gaps:51/384 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RLLLRNYSLMEAV----KRLLPR----PRKKIYNLGACF------------EL-----VDIPKIS 41
            ||.|....|||.:    :|||||    |......:|:.|            ||     :.:|.| 
Human    10 RLRLGERGLMEPLLPPKRRLLPRVRLLPLLLALAVGSAFYTIWSGWHRRTEELPLGRELRVPLI- 73

  Fly    42 YNPSELSEPRFLEYSNLSDKLHLREA-IDKILIPRVVGTTNHSIVREYIVQSLRDL--DWDVEVN 103
               ..|.|.|........|...|... :..:|:.|..|:..:..||:::..:||.|  .|.||::
Human    74 ---GSLPEARLRRVVGQLDPQRLWSTYLRPLLVVRTPGSPGNLQVRKFLEATLRSLTAGWHVELD 135

  Fly   104 SFHDHAPIKGKLHFHNIIATLNPNAERYLVLSCHYDSKYMP--GVEFLGATDSAVPCAMLLNLAQ 166
            .|....|: |.:.|.|::|||:|.|.|:|.|:||||||..|  ...|:||||||||||:||.|||
Human   136 PFTASTPL-GPVDFGNVVATLDPRAARHLTLACHYDSKLFPPGSTPFVGATDSAVPCALLLELAQ 199

  Fly   167 VLQEQLKPLKK--SKLSLMLLFFDGEEAFEEWGPKDSIYGARHLAKKW----HHEG--KLDRIDM 223
            .|..:|...||  :.::|.|||.|||||.:|||||||:||:||||:..    |..|  ::..|::
Human   200 ALDLELSRAKKQAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIEL 264

  Fly   224 LVLLDLLGAPDPAFYSFFENTESWYMRIQSVETRLAKLQLLERYASSGVAQRDPTRYFQSQAMRS 288
            .:||||||||:|.|||.|..|..|:.|::|:|.||.:|.||:.:...       ..|||......
Human   265 FMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQE-------VMYFQPGEPFG 322

  Fly   289 SFIEDDHIPFLRRNVPILHLIPVPFPSVWHTPDDNASVIDYATTDNLALIIRLFALEYL 347
            | :||||||||||.||:||||..|||:|||||.|....:...|..||..|:.:|..|||
Human   323 S-VEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYL 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
isoQCNP_788550.1 M28_QC_like 56..346 CDD:193501 135/302 (45%)
QPCTLNP_060129.2 M28_QC_like 79..379 CDD:193501 136/308 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 235 1.000 Domainoid score I2376
eggNOG 1 0.900 - - E1_KOG3946
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 263 1.000 Inparanoid score I3088
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55920
OrthoDB 1 1.010 - - D1257754at2759
OrthoFinder 1 1.000 - - FOG0001509
OrthoInspector 1 1.000 - - mtm8656
orthoMCL 1 0.900 - - OOG6_102560
Panther 1 1.100 - - LDO PTHR12283
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2349
SonicParanoid 1 1.000 - - X1074
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.