DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment isoQC and Qpctl

DIOPT Version :9

Sequence 1:NP_788550.1 Gene:isoQC / 40270 FlyBaseID:FBgn0036999 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001099700.1 Gene:Qpctl / 292687 RGDID:1308128 Length:383 Species:Rattus norvegicus


Alignment Length:380 Identity:159/380 - (41%)
Similarity:221/380 - (58%) Gaps:48/380 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RLLLRNYSLMEAVKRLLPRPR-----KKIYNLGACFELVDIPKISYNP--SELSEPRFLE---YS 56
            |.|::..||.:  :|||||.:     .....||..|.:|   ..|::|  .|:|..|.|.   ..
  Rat    16 RGLMKPPSLSK--RRLLPRVQLLPLLLLALALGLAFYIV---WNSWHPGVEEVSRSRDLRVPLIG 75

  Fly    57 NLSD-KLHL-----------REAIDKILIPRVVGTTNHSIVREYIVQSLRDLD--WDVEVNSFHD 107
            :||: ||.|           ...:..:||.|..|:..:..||:::..:|:.|.  |.||::.|..
  Rat    76 SLSEAKLRLVVGQLDPQRLWGTFLRPLLIVRPPGSPGNLQVRKFLEATLQSLSAGWHVELDPFTA 140

  Fly   108 HAPIKGKLHFHNIIATLNPNAERYLVLSCHYDSKYM-PGV-EFLGATDSAVPCAMLLNLAQVLQE 170
            ..|: |.|.|.|::|||:|.|.|:|.|:||||||:. ||: .|:||||||||||:||.|.|.|..
  Rat   141 STPL-GPLDFGNVVATLDPGAARHLTLACHYDSKFFPPGLPPFVGATDSAVPCALLLELVQALDV 204

  Fly   171 QLKPLKK--SKLSLMLLFFDGEEAFEEWGPKDSIYGARHLAKKW----HHEG--KLDRIDMLVLL 227
            .|..:|:  :.::|.|||.|||||.:|||||||:||:||||:..    |..|  ::..|::.|||
  Rat   205 MLSRIKQQAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQIMESIPHSPGPTRIQAIELFVLL 269

  Fly   228 DLLGAPDPAFYSFFENTESWYMRIQSVETRLAKLQLLERYASSGVAQRDPTRYFQSQAMRSSFIE 292
            ||||||.|.|:|.|..|..|:.|::|:|.||.:|.||:.:...       ..|||....... :|
  Rat   270 DLLGAPSPIFFSHFPRTARWFQRLRSIEKRLHRLNLLQSHPQE-------VMYFQPGEPPGP-VE 326

  Fly   293 DDHIPFLRRNVPILHLIPVPFPSVWHTPDDNASVIDYATTDNLALIIRLFALEYL 347
            |||||||||.||:||||.:|||:|||||.|..:.:...|..||:.|:.:|..|||
  Rat   327 DDHIPFLRRGVPVLHLIAMPFPAVWHTPADTEANLHPPTVHNLSRILAVFLAEYL 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
isoQCNP_788550.1 M28_QC_like 56..346 CDD:193501 137/313 (44%)
QpctlNP_001099700.1 M28_QC_like 80..380 CDD:193501 135/308 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 229 1.000 Domainoid score I2392
eggNOG 1 0.900 - - E1_KOG3946
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 256 1.000 Inparanoid score I3082
OMA 1 1.010 - - QHG55920
OrthoDB 1 1.010 - - D1257754at2759
OrthoFinder 1 1.000 - - FOG0001509
OrthoInspector 1 1.000 - - mtm9135
orthoMCL 1 0.900 - - OOG6_102560
Panther 1 1.100 - - LDO PTHR12283
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1074
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.