DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment isoQC and QPCT

DIOPT Version :9

Sequence 1:NP_788550.1 Gene:isoQC / 40270 FlyBaseID:FBgn0036999 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_036545.1 Gene:QPCT / 25797 HGNCID:9753 Length:361 Species:Homo sapiens


Alignment Length:370 Identity:161/370 - (43%)
Similarity:222/370 - (60%) Gaps:46/370 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRLLLRNYSLMEAVKRLLPR----PRKKIYNLGACFELVDIPKISYNPSELSEPRFLEYSNLSDK 61
            :.|||...:|..|.:.:.|.    |.:|.|:..|..          |.|.|.:  ..|.:::|:.
Human    13 LHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAIL----------NSSALRQ--IAEGTSISEM 65

  Fly    62 LHLREAIDKILIPRVVGTTNHSIVREYIVQSLRDL--DWDVEVNSFHDHAPIKGKLHFHNIIATL 124
              .:..:..:||.|..|:......|::|:|.::.|  ||.:|:::|....|. |...|.|||:||
Human    66 --WQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPY-GYRSFSNIISTL 127

  Fly   125 NPNAERYLVLSCHYDSKYMP---GVEFLGATDSAVPCAMLLNLAQVLQEQLKPLK-----KSKLS 181
            ||.|:|:|||:|||||||..   ...|:|||||||||||:|.||:.|.::|..||     |..||
Human   128 NPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLS 192

  Fly   182 LMLLFFDGEEAFEEWGPKDSIYGARHLAKKW----HHEG-----KLDRIDMLVLLDLLGAPDPAF 237
            |.|:||||||||..|.|:||:||:||||.|.    |..|     :|..:|:||||||:|||:|.|
Human   193 LQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTF 257

  Fly   238 YSFFENTESWYMRIQSVETRLAKLQLLERYASSGVAQRDPTRYFQSQAMRSSFIEDDHIPFLRRN 302
            .:||.|:..|:.|:|::|..|.:|.||:.::..|       ||||:.:. ...|:|||||||||.
Human   258 PNFFPNSARWFERLQAIEHELHELGLLKDHSLEG-------RYFQNYSY-GGVIQDDHIPFLRRG 314

  Fly   303 VPILHLIPVPFPSVWHTPDDNASVIDYATTDNLALIIRLFALEYL 347
            ||:|||||.|||.||||.|||...:|.:|.|||..|:::|.||||
Human   315 VPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYL 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
isoQCNP_788550.1 M28_QC_like 56..346 CDD:193501 144/308 (47%)
QPCTNP_036545.1 M28_QC_like 51..358 CDD:193501 147/319 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 235 1.000 Domainoid score I2376
eggNOG 1 0.900 - - E1_KOG3946
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8238
Inparanoid 1 1.050 263 1.000 Inparanoid score I3088
Isobase 1 0.950 - 0.861353 Normalized mean entropy S1680
OMA 1 1.010 - - QHG55920
OrthoDB 1 1.010 - - D1257754at2759
OrthoFinder 1 1.000 - - FOG0001509
OrthoInspector 1 1.000 - - mtm8656
orthoMCL 1 0.900 - - OOG6_102560
Panther 1 1.100 - - O PTHR12283
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2349
SonicParanoid 1 1.000 - - X1074
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.820

Return to query results.
Submit another query.