DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment isoQC and H27A22.1

DIOPT Version :9

Sequence 1:NP_788550.1 Gene:isoQC / 40270 FlyBaseID:FBgn0036999 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001041144.1 Gene:H27A22.1 / 179482 WormBaseID:WBGene00010418 Length:356 Species:Caenorhabditis elegans


Alignment Length:310 Identity:127/310 - (40%)
Similarity:182/310 - (58%) Gaps:34/310 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 NLSDKLHLREAIDKILIPRVVGTTNHSIVREYIVQSLRDLDWDVEVNSFHDHAPIKGKLHFHNII 121
            :.::....:|.:..|::||:|.|..|..|.:|:...|.:|.:..|.::|.|..|: |..:|.|:|
 Worm    57 DFTNTTRFKEILAPIMVPRIVDTKQHRQVGDYLQSFLHNLGFATEWDAFTDTTPL-GTRNFRNLI 120

  Fly   122 ATLNPNAERYLVLSCHYDSKYMPGVEFLGATDSAVPCAMLLNLAQVLQEQLKPLKKSKLSLMLLF 186
            ||.:.:|.|.|||:||||||.:||...:.||||||||||:|::||.|...:......::.|.|:|
 Worm   121 ATFDESAPRRLVLACHYDSKIIPGQVMIAATDSAVPCAMMLDIAQTLAPYMYKRVAQQIGLQLIF 185

  Fly   187 FDGEEAFEEWGPKDSIYGARHLAKKWHHE--------------GKLDRIDMLVLLDLLGAPDPAF 237
            |||||||.:|...||:||:||||:||..:              .:|||||:|:|||||||.:|: 
 Worm   186 FDGEEAFRDWTATDSLYGSRHLAQKWEQKWYPSSSSLNNFELSKELDRIDVLMLLDLLGAANPS- 249

  Fly   238 YSFFENT-----ESWYMRIQSVETRLAKLQLLERYASSGVAQRDPTRYFQSQAMRSSFIEDDHIP 297
               ..||     ...:.::..||:.|         .:||.........|..| :..:.:||||||
 Worm   250 ---IGNTIGMGANDLFSQLADVESNL---------RTSGCLSSLRRNVFNKQ-LSYNQVEDDHIP 301

  Fly   298 FLRRNVPILHLIPVPFPSVWHTPDDNASVIDYATTDNLALIIRLFALEYL 347
            ||:|.|||||||.||||||||...|||:.:.|.|.|::..:||:|..:||
 Worm   302 FLKRGVPILHLITVPFPSVWHRSSDNANALHYPTIDHMTAVIRVFVAKYL 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
isoQCNP_788550.1 M28_QC_like 56..346 CDD:193501 125/307 (41%)
H27A22.1NP_001041144.1 M28_QC_like 50..350 CDD:349876 125/307 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55920
OrthoDB 1 1.010 - - D1257754at2759
OrthoFinder 1 1.000 - - FOG0001509
OrthoInspector 1 1.000 - - otm14729
orthoMCL 1 0.900 - - OOG6_102560
Panther 1 1.100 - - LDO PTHR12283
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2349
SonicParanoid 1 1.000 - - X1074
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.960

Return to query results.
Submit another query.