powered by:
Protein Alignment CG5969 and vma21
DIOPT Version :9
Sequence 1: | NP_788549.1 |
Gene: | CG5969 / 40269 |
FlyBaseID: | FBgn0036998 |
Length: | 105 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001037928.1 |
Gene: | vma21 / 733545 |
XenbaseID: | XB-GENE-5730849 |
Length: | 104 |
Species: | Xenopus tropicalis |
Alignment Length: | 74 |
Identity: | 22/74 - (29%) |
Similarity: | 45/74 - (60%) |
Gaps: | 5/74 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 SSFKTVLFYCMLIVFLPVLTFFVLKGFVLDQFLDISEVKVNIASAVGAVVALHIALGLYIYRAYF 94
::.||:||:.:|::.||:..:|..|.:|.:....:|.......:|:.||||:|:.|.:::|.|:
Frog 28 ATLKTLLFFTVLMIMLPIGLYFSSKVYVFEGTYGMSNRDSYFYAAIVAVVAVHVVLAMFVYVAW- 91
Fly 95 GAPGSKGSK 103
::||:
Frog 92 ----NEGSR 96
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG5969 | NP_788549.1 |
VMA21 |
32..93 |
CDD:286525 |
19/60 (32%) |
vma21 | NP_001037928.1 |
VMA21 |
29..91 |
CDD:370497 |
19/61 (31%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0006620 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR31792 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.010 |
|
Return to query results.
Submit another query.