DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5969 and vma21

DIOPT Version :9

Sequence 1:NP_788549.1 Gene:CG5969 / 40269 FlyBaseID:FBgn0036998 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_001037928.1 Gene:vma21 / 733545 XenbaseID:XB-GENE-5730849 Length:104 Species:Xenopus tropicalis


Alignment Length:74 Identity:22/74 - (29%)
Similarity:45/74 - (60%) Gaps:5/74 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SSFKTVLFYCMLIVFLPVLTFFVLKGFVLDQFLDISEVKVNIASAVGAVVALHIALGLYIYRAYF 94
            ::.||:||:.:|::.||:..:|..|.:|.:....:|.......:|:.||||:|:.|.:::|.|: 
 Frog    28 ATLKTLLFFTVLMIMLPIGLYFSSKVYVFEGTYGMSNRDSYFYAAIVAVVAVHVVLAMFVYVAW- 91

  Fly    95 GAPGSKGSK 103
                ::||:
 Frog    92 ----NEGSR 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5969NP_788549.1 VMA21 32..93 CDD:286525 19/60 (32%)
vma21NP_001037928.1 VMA21 29..91 CDD:370497 19/61 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006620
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR31792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.