DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5969 and Vma21

DIOPT Version :9

Sequence 1:NP_788549.1 Gene:CG5969 / 40269 FlyBaseID:FBgn0036998 Length:105 Species:Drosophila melanogaster
Sequence 2:XP_006528324.1 Gene:Vma21 / 67048 MGIID:1914298 Length:161 Species:Mus musculus


Alignment Length:100 Identity:27/100 - (27%)
Similarity:55/100 - (55%) Gaps:9/100 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KNKKAAGGNGVAPKQTRQQSHDSQDYSSFKTVLFYCMLIVFLPVLTFFVLKGFVLDQFLDISEVK 68
            :|...|.|.  .|:..|  .:::...::.||:||:..|::.:|:..:|..|.::.:..|.:|...
Mouse    63 ENDPLAAGR--TPRTPR--GNENSLAATLKTLLFFTALMITVPIGLYFTTKAYIFEGALGMSNRD 123

  Fly    69 VNIASAVGAVVALHIALGLYIYRAYFGAPGSKGSK 103
            ....:|:.||||:|:.|.|::|.|:     ::||:
Mouse   124 SYFYAAIVAVVAVHVVLALFVYVAW-----NEGSR 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5969NP_788549.1 VMA21 32..93 CDD:286525 19/60 (32%)
Vma21XP_006528324.1 VMA21 86..148 CDD:370497 19/61 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4783
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006620
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109226
Panther 1 1.100 - - O PTHR31792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.770

Return to query results.
Submit another query.