DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5969 and Vma21

DIOPT Version :9

Sequence 1:NP_788549.1 Gene:CG5969 / 40269 FlyBaseID:FBgn0036998 Length:105 Species:Drosophila melanogaster
Sequence 2:XP_008769566.1 Gene:Vma21 / 501658 RGDID:1566155 Length:120 Species:Rattus norvegicus


Alignment Length:100 Identity:27/100 - (27%)
Similarity:55/100 - (55%) Gaps:9/100 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KNKKAAGGNGVAPKQTRQQSHDSQDYSSFKTVLFYCMLIVFLPVLTFFVLKGFVLDQFLDISEVK 68
            :|...|.|.  .|:..|  .:::...::.||:||:..|::.:|:..:|..|.::.:..|.:|...
  Rat    22 ENDPLAAGR--TPRTPR--GNENSLAATLKTLLFFTALMITVPIGLYFTTKSYIFEGALGMSNRD 82

  Fly    69 VNIASAVGAVVALHIALGLYIYRAYFGAPGSKGSK 103
            ....:|:.||||:|:.|.|::|.|:     ::||:
  Rat    83 SYFYAAIVAVVAVHVVLALFVYVAW-----NEGSR 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5969NP_788549.1 VMA21 32..93 CDD:286525 19/60 (32%)
Vma21XP_008769566.1 VMA21 45..107 CDD:401413 19/61 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006620
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109226
Panther 1 1.100 - - O PTHR31792
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.