DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5969 and CG13829

DIOPT Version :10

Sequence 1:NP_788549.1 Gene:CG5969 / 40269 FlyBaseID:FBgn0036998 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_651129.1 Gene:CG13829 / 42740 FlyBaseID:FBgn0039059 Length:211 Species:Drosophila melanogaster


Alignment Length:73 Identity:29/73 - (39%)
Similarity:42/73 - (57%) Gaps:6/73 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DSQDYSSFKTVLF---YCMLIVFLPVLTFFVLKGFVLDQFLDISEVKVNIASAVGAVVALHIALG 86
            ::|.:.|...||.   ||.||:..|:.|||.||..||..:   :.:..:|.|.:..|||:|.|:|
  Fly   129 NTQIHGSVFIVLLLMSYCSLIIGFPIATFFALKFVVLKSY---AHINADIISTICTVVAVHAAVG 190

  Fly    87 LYIYRAYF 94
            .|||||.:
  Fly   191 FYIYRAIY 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5969NP_788549.1 VMA21 30..93 CDD:462801 27/65 (42%)
CG13829NP_651129.1 VMA21 <62..109 CDD:462801
VMA21 138..197 CDD:462801 26/61 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.