DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5969 and CG42359

DIOPT Version :9

Sequence 1:NP_788549.1 Gene:CG5969 / 40269 FlyBaseID:FBgn0036998 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_732404.2 Gene:CG42359 / 42299 FlyBaseID:FBgn0259705 Length:132 Species:Drosophila melanogaster


Alignment Length:108 Identity:27/108 - (25%)
Similarity:52/108 - (48%) Gaps:11/108 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTKNKK--------AAGGNGVAPKQTRQQSHDSQDYSS---FKTVLFYCMLIVFLPVLTFFVLK 54
            |..||:|        |...:..|...:..:.|..|:.:|   |..:|.|.:|:..||.|.|:.::
  Fly     1 MGKKNRKQQHVDVVPATTDDSPAVIDSPVEHHTQQEDTSAEVFLWLLAYSVLMFTLPFLGFYGVR 65

  Fly    55 GFVLDQFLDISEVKVNIASAVGAVVALHIALGLYIYRAYFGAP 97
            .::.:.|..:....||..|.:.|||.:::.:.:|:.:|:...|
  Fly    66 SWLQESFPHLDLFTVNCWSVLTAVVVVNLVVAMYVLKAFREKP 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5969NP_788549.1 VMA21 32..93 CDD:286525 16/60 (27%)
CG42359NP_732404.2 VMA21 41..>84 CDD:286525 11/42 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458111
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.