powered by:
Protein Alignment CG5969 and pdcd-2
DIOPT Version :9
Sequence 1: | NP_788549.1 |
Gene: | CG5969 / 40269 |
FlyBaseID: | FBgn0036998 |
Length: | 105 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_497896.1 |
Gene: | pdcd-2 / 259501 |
WormBaseID: | WBGene00011116 |
Length: | 386 |
Species: | Caenorhabditis elegans |
Alignment Length: | 30 |
Identity: | 10/30 - (33%) |
Similarity: | 13/30 - (43%) |
Gaps: | 1/30 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 KNKKAAGGNGVAP-KQTRQQSHDSQDYSSF 32
:|...:..|..|. |..|.|...:.||.||
Worm 92 RNPSCSRTNDAANLKAFRCQLPRANDYYSF 121
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0006620 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
oto20578 |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_109226 |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR31792 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.910 |
|
Return to query results.
Submit another query.