DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5969 and pdcd-2

DIOPT Version :9

Sequence 1:NP_788549.1 Gene:CG5969 / 40269 FlyBaseID:FBgn0036998 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_497896.1 Gene:pdcd-2 / 259501 WormBaseID:WBGene00011116 Length:386 Species:Caenorhabditis elegans


Alignment Length:30 Identity:10/30 - (33%)
Similarity:13/30 - (43%) Gaps:1/30 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KNKKAAGGNGVAP-KQTRQQSHDSQDYSSF 32
            :|...:..|..|. |..|.|...:.||.||
 Worm    92 RNPSCSRTNDAANLKAFRCQLPRANDYYSF 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5969NP_788549.1 VMA21 32..93 CDD:286525 1/1 (100%)
pdcd-2NP_497896.1 zf-MYND 146..182 CDD:366792
PDCD2_C 269..384 CDD:367865
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006620
OrthoInspector 1 1.000 - - oto20578
orthoMCL 1 0.900 - - OOG6_109226
Panther 1 1.100 - - O PTHR31792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.