DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5969 and R07E5.7

DIOPT Version :9

Sequence 1:NP_788549.1 Gene:CG5969 / 40269 FlyBaseID:FBgn0036998 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_497898.1 Gene:R07E5.7 / 175577 WormBaseID:WBGene00011115 Length:191 Species:Caenorhabditis elegans


Alignment Length:79 Identity:19/79 - (24%)
Similarity:35/79 - (44%) Gaps:4/79 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 APKQTRQQSHDSQDYS--SFKTVLFYCMLIVFLPVLTFFVLKGFV-LDQF-LDISEVKVNIASAV 75
            ||.:..|:...:.::|  :...::.:..::..||:|....|..:| :|.| |..:|..:......
 Worm    94 APIRPDQEQFYTAEHSNRAITLLIAFSAMMFTLPLLVMASLYYWVFIDHFHLPPAEAMLYAGVCA 158

  Fly    76 GAVVALHIALGLYI 89
            ..||.|..|...||
 Worm   159 ALVVILIAAAFCYI 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5969NP_788549.1 VMA21 32..93 CDD:286525 15/60 (25%)
R07E5.7NP_497898.1 VMA21 111..174 CDD:286525 15/62 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR31792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.