DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5955 and ERG26

DIOPT Version :9

Sequence 1:NP_649230.1 Gene:CG5955 / 40268 FlyBaseID:FBgn0036997 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_011514.1 Gene:ERG26 / 852883 SGDID:S000002969 Length:349 Species:Saccharomyces cerevisiae


Alignment Length:220 Identity:46/220 - (20%)
Similarity:84/220 - (38%) Gaps:56/220 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SRPPKILITGGLGQLGIECAKLLRTQYGSQNVILSDIIKPSQSVLENGPYIFADILDFKG----- 102
            |:...:||.||.|.||:...:.........::.:.|:....:.:.:...:...||...||     
Yeast     2 SKIDSVLIIGGSGFLGLHLIQQFFDINPKPDIHIFDVRDLPEKLSKQFTFNVDDIKFHKGDLTSP 66

  Fly   103 --LQKIVVDHRIDWLIHFSALLSAVGEQNVPLAVRVNIEGVHNVIELAKQYKLRIFV-PSTIGA- 163
              ::..:.:.:.:.::|.:   |.:..||..:...||::|..|||::.|:..:.|.| .|:.|. 
Yeast    67 DDMENAINESKANVVVHCA---SPMHGQNPDIYDIVNVKGTRNVIDMCKKCGVNILVYTSSAGVI 128

  Fly   164 FGPDSPRN-----PTPNVTIQRPRTIYGVSKVHAELIGEYYYHKFGLDFRCLRFPGVISSDPPGG 223
            |......|     |.|.|    |...|..:|..||.:                   |:.::.|  
Yeast   129 FNGQDVHNADETWPIPEV----PMDAYNETKAIAEDM-------------------VLKANDP-- 168

  Fly   224 GTTDYAVAVFHEALRNGKYTCYLRP 248
             ::|:             ||..|||
Yeast   169 -SSDF-------------YTVALRP 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5955NP_649230.1 WcaG 47..355 CDD:223528 45/216 (21%)
TDH_SDR_e 47..351 CDD:187580 45/216 (21%)
ERG26NP_011514.1 3b-HSD-NSDHL-like_SDR_e 6..345 CDD:187673 45/216 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.