DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5955 and ARI1

DIOPT Version :9

Sequence 1:NP_649230.1 Gene:CG5955 / 40268 FlyBaseID:FBgn0036997 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_011358.3 Gene:ARI1 / 852720 SGDID:S000003125 Length:347 Species:Saccharomyces cerevisiae


Alignment Length:379 Identity:63/379 - (16%)
Similarity:121/379 - (31%) Gaps:104/379 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 ILITGGLGQLGIECAKLLRTQYGSQNVILSDIIKPSQSVLENG---------------------- 90
            :.::|..|.:.:.              |::|::|...:|:.:|                      
Yeast     7 VFVSGATGFIALH--------------IMNDLLKAGYTVIGSGRSQEKNDGLLKKFNNNPKLSME 57

  Fly    91 -------PYIFADILDFKGLQKIVVDHRIDWLIHFSA------LLSAVGEQNVPLAVRVNIEGVH 142
                   |..|.::....|.:..:|.|... ..||..      ||:..            :.|..
Yeast    58 IVEDIAAPNAFDEVFKKHGKEIKIVLHTAS-PFHFETTNFEKDLLTPA------------VNGTK 109

  Fly   143 NVIELAKQYKL----RIFVPSTIGAFGPDSPRNPTPNVTIQRPRTIYGVSKVHAELIGEY----- 198
            :::|..|:|..    ::.|.|:..|....:..|....|..:............|..:..|     
Yeast   110 SILEAIKKYAADTVEKVIVTSSTAALVTPTDMNKGDLVITEESWNKDTWDSCQANAVAAYCGSKK 174

  Fly   199 YYHKFGLDF-----RCLRF------PGVI-------SSDPPGGGTTDYAVAVFHEALRNGKYTCY 245
            :..|...:|     ..::|      ||.:       .|...|..|:...|:....:...|::..|
Yeast   175 FAEKTAWEFLKENKSSVKFTLSTINPGFVFGPQMFADSLKHGINTSSGIVSELIHSKVGGEFYNY 239

  Fly   246 LRPDTRLPMMYIEDCLRALLEFMRAPNEQLKRRVYNVTAMSFTPEELFAQLGKHVPNLH---VTY 307
            ..     |.:.:.|..:|.|..:..|....:|.|  ::...|..:|:...|.:..|.|.   .|.
Yeast   240 CG-----PFIDVRDVSKAHLVAIEKPECTGQRLV--LSEGLFCCQEIVDILNEEFPQLKGKIATG 297

  Fly   308 KPDSRQLIADAWPQVFDDSDARRDWHWQHKYDLSNLVDFMIKDVQDNYINVQPE 361
            :|.:.....:.....||:|..::...:|    ..||.|.:: |.....:.||.|
Yeast   298 EPATGPSFLEKNSCKFDNSKTKKLLGFQ----FYNLKDCIV-DTAAQMLEVQNE 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5955NP_649230.1 WcaG 47..355 CDD:223528 60/371 (16%)
TDH_SDR_e 47..351 CDD:187580 59/367 (16%)
ARI1NP_011358.3 AR_SDR_e 6..323 CDD:187538 55/349 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345640
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.