DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5955 and YDR541C

DIOPT Version :9

Sequence 1:NP_649230.1 Gene:CG5955 / 40268 FlyBaseID:FBgn0036997 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_010830.4 Gene:YDR541C / 852154 SGDID:S000002949 Length:344 Species:Saccharomyces cerevisiae


Alignment Length:142 Identity:31/142 - (21%)
Similarity:50/142 - (35%) Gaps:40/142 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 ILITGGLGQLGIEC---------------------AKLLRTQYGSQNVILSDIIKPSQSVLENGP 91
            :|::|..|.:.:..                     |||||....:.|:.|.  |.|..|    .|
Yeast     5 VLVSGASGFIALHILSQLLKQDYKVIGTVRSHEKEAKLLRQFQHNPNLTLE--IVPDIS----HP 63

  Fly    92 YIFADILDFKGLQKIVVDHRIDWLIH-FSALLSAVGEQNVPLAVRVNIEGVHNVIELAKQYKL-- 153
            ..|..:|..:|       ..|.:::| .|.......|....|.:.. :||..|::...|:|..  
Yeast    64 NAFDKVLQKRG-------REIRYVLHTASPFHYDTTEYEKDLLIPA-LEGTKNILNSIKKYAADT 120

  Fly   154 --RIFVPSTIGA 163
              |:.|.|:..|
Yeast   121 VERVVVTSSCTA 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5955NP_649230.1 WcaG 47..355 CDD:223528 31/142 (22%)
TDH_SDR_e 47..351 CDD:187580 31/142 (22%)
YDR541CNP_010830.4 AR_SDR_e 4..320 CDD:187538 31/142 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345642
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.