DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5955 and YLL056C

DIOPT Version :9

Sequence 1:NP_649230.1 Gene:CG5955 / 40268 FlyBaseID:FBgn0036997 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_013044.1 Gene:YLL056C / 850670 SGDID:S000003979 Length:298 Species:Saccharomyces cerevisiae


Alignment Length:278 Identity:52/278 - (18%)
Similarity:86/278 - (30%) Gaps:89/278 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KILITGGLGQLGI-----------ECAKLLRTQYGSQNVILSDIIKPSQSVLENGPYIFADILDF 100
            |:.|||..|.:|.           |...|.|:...:..:   ..|.|:..:|.      .|:.|.
Yeast     2 KVFITGASGFIGSAVLSELISSGHEVVGLARSDEAAAKI---KSIDPAAKILR------GDLKDL 57

  Fly   101 KGLQKIVVDHRIDWLIHFSALLSAVGE-QNVPLAVRVNIEGVHNVIELAKQYKLRIFVPSTIGAF 164
            :.|:|...:.  |.:||    |..|.: :|......::.:....::|..|               
Yeast    58 EILKKGATES--DGVIH----LGFVHDFKNFEQCCEIDRQATVAMLESLK--------------- 101

  Fly   165 GPDSPRNPTPNVTIQRPRTIYG----------VSKVHAELIGEYYYHKFGLDFRCLRFPGVI--- 216
            |.:.|...|......||..:..          :.:...|.:...|..| |:..|.:|.|..:   
Yeast   102 GSNKPFLYTNGTLSLRPNKVANEQDGIDEDSKILRAVTEQVALSYKDK-GVSARIVRLPFSVHGK 165

  Fly   217 -----------------SSDPPGGGTTDYAVA-------VFHEALRNGK----YTCYLRPDTRLP 253
                             .|...|.||..:|..       :|...|..||    |.|.  .:..:|
Yeast   166 GDKAFVPILMNIAKAAGKSGYVGQGTNAWAAVHRLDTAPLFRLVLEKGKTGQVYHCV--GEQGIP 228

  Fly   254 MMYIEDCLRALLEFMRAP 271
               .:|..|.:.|.:..|
Yeast   229 ---FKDIARVIGEILNVP 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5955NP_649230.1 WcaG 47..355 CDD:223528 52/278 (19%)
TDH_SDR_e 47..351 CDD:187580 52/278 (19%)
YLL056CNP_013044.1 SDR_a7 1..291 CDD:187572 52/278 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.