DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tdh and AT1G51410

DIOPT Version :10

Sequence 1:NP_649230.1 Gene:Tdh / 40268 FlyBaseID:FBgn0036997 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_175552.2 Gene:AT1G51410 / 841566 AraportID:AT1G51410 Length:325 Species:Arabidopsis thaliana


Alignment Length:148 Identity:26/148 - (17%)
Similarity:52/148 - (35%) Gaps:60/148 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LLRTQYGSQNVILSDIIKPSQSVLENGPYIFADILD-----FKGLQKIVVDHR---IDWLIHFSA 120
            ||:....:....:..:||.:|: ..|..:.:.::.|     .:..:....|.|   ::.:.|:|.
plant   198 LLQPTLNTSAAAVLSLIKGAQT-FPNATFGWVNVKDVANAHIQAFENPDADGRYCLVERVAHYSE 261

  Fly   121 LLSAVGEQNVPLAVRVNIEGVHNVIELAKQYKL-------RIFVPSTIGAFGPDSPRNPTPNVTI 178
            :              |||  :|   :|...::|       :|::|:                   
plant   262 V--------------VNI--LH---DLYPDFQLPEKCADEKIYIPT------------------- 288

  Fly   179 QRPRTIYGVSKVHAELIG 196
                  |.|||..||.:|
plant   289 ------YKVSKEKAESLG 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TdhNP_649230.1 TDH_SDR_e 47..351 CDD:187580 26/148 (18%)
AT1G51410NP_175552.2 PLN02662 3..324 CDD:178268 26/148 (18%)

Return to query results.
Submit another query.