DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tdh and AT1G09490

DIOPT Version :10

Sequence 1:NP_649230.1 Gene:Tdh / 40268 FlyBaseID:FBgn0036997 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_172420.1 Gene:AT1G09490 / 837474 AraportID:AT1G09490 Length:322 Species:Arabidopsis thaliana


Alignment Length:67 Identity:18/67 - (26%)
Similarity:26/67 - (38%) Gaps:14/67 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 TSPNNPDGSIISEDDLLKILEMPILVVLDEAYIEFSGVESRMKWVKKYENLIVLRTFSKRAGLAG 170
            |:.:||...:.|...||....:            |.||.  ::..||..:.|...:..|..||.|
plant    20 TTTSNPSPKLHSSASLLSQKTV------------FQGVS--LEDSKKSVSEIFAVSERKIGGLNG 70

  Fly   171 LR 172
            ||
plant    71 LR 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TdhNP_649230.1 TDH_SDR_e 47..351 CDD:187580 18/67 (27%)
AT1G09490NP_172420.1 Rossmann-fold NAD(P)(+)-binding proteins 1..322 CDD:473865 18/67 (27%)

Return to query results.
Submit another query.