DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tdh and AT5G14700

DIOPT Version :10

Sequence 1:NP_649230.1 Gene:Tdh / 40268 FlyBaseID:FBgn0036997 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_196974.1 Gene:AT5G14700 / 831322 AraportID:AT5G14700 Length:368 Species:Arabidopsis thaliana


Alignment Length:177 Identity:36/177 - (20%)
Similarity:58/177 - (32%) Gaps:38/177 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 ILITGGLGQLGIECAKLLRTQYGSQNVIL---SDIIKPSQSVLENGPYIFADILDFKGLQKIVVD 109
            :.:|||:..||....|.|.....|..:::   .|..|.|:...:      |:...|..:...||.
plant    55 VCVTGGVSYLGRAIVKRLLVHGYSVRIVVDCPEDKEKVSEMEAD------AETASFSNMITSVVS 113

  Fly   110 H--RIDWLI----------HFSALLSAVG-----EQNVPLAVRVNIEGVHNVIELAKQYKLRIFV 157
            .  .||.||          |.||.:...|     :....|..:|: |.|..........:..:|.
plant   114 RLTEIDSLIKAFDGCAGVFHTSAFVDPAGVSGYSKSMAELEAKVS-ESVIEACTRTASVRKCVFT 177

  Fly   158 PSTIGAFGPDSPRNPTPNVTIQRP-----------RTIYGVSKVHAE 193
            .|.:......:|.|...:..|...           :..|.:.|:.||
plant   178 SSLLACAWQKNPCNSLDHSVINEESWSDEQLCIDNKLWYALGKLKAE 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TdhNP_649230.1 TDH_SDR_e 47..351 CDD:187580 36/177 (20%)
AT5G14700NP_196974.1 PLN02686 1..368 CDD:215370 36/177 (20%)

Return to query results.
Submit another query.