DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tdh and AT2G43420

DIOPT Version :10

Sequence 1:NP_649230.1 Gene:Tdh / 40268 FlyBaseID:FBgn0036997 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_565998.1 Gene:AT2G43420 / 818943 AraportID:AT2G43420 Length:561 Species:Arabidopsis thaliana


Alignment Length:202 Identity:46/202 - (22%)
Similarity:81/202 - (40%) Gaps:39/202 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LITGGLGQLGIE-CAKLLRTQYGSQNVILSDI-----IKPSQSVLEN------GPYIFADILDFK 101
            ::.||.|.:|.. .::|||  .|:..|.::|.     :..|.|:||:      ..|...|:.|..
plant    16 VVLGGRGFIGRSLVSRLLR--LGNWTVRVADSGHTLHLDESDSLLEDALSSGRASYHCVDVRDKP 78

  Fly   102 GLQKIVVDHRIDWLIHFSALLSAVGEQNVPLAVRVNIEGVHNVIELAKQYKLR----------IF 156
            .:.|:.....:.:.:..:.|.|    .:.....:|.::|..|||...::..:|          :|
plant    79 QIVKVTEGSYVVFYMGATDLRS----HDYFDCYKVIVQGTRNVISACRESGVRKLIYNSTADVVF 139

  Fly   157 VPSTIGAFGPDSPRNPTPNVTIQRPRTIYGVSKVHAELIGEYYYHKFGLDFRCLRFPGVISSDPP 221
            ..|.....|.:|.|.|   :..|...|.:   |..||.:.:...::.||....||     ||...
plant   140 DGSQPIRDGDESLRRP---LKFQSMLTDF---KAQAEALIKLANNRDGLLTCALR-----SSIVF 193

  Fly   222 GGGTTDY 228
            |.|.|::
plant   194 GPGDTEF 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TdhNP_649230.1 TDH_SDR_e 47..351 CDD:187580 46/202 (23%)
AT2G43420NP_565998.1 3b-HSD-NSDHL-like_SDR_e 14..354 CDD:187673 46/202 (23%)
Reticulon 379..537 CDD:460562
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.