DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tdh and 3BETAHSD/D2

DIOPT Version :10

Sequence 1:NP_649230.1 Gene:Tdh / 40268 FlyBaseID:FBgn0036997 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_180194.2 Gene:3BETAHSD/D2 / 817166 AraportID:AT2G26260 Length:564 Species:Arabidopsis thaliana


Alignment Length:241 Identity:51/241 - (21%)
Similarity:77/241 - (31%) Gaps:102/241 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LITGGLGQLGIECAKLLRTQYGSQNVILSDI-----IKPSQ--SVLENG------PYIFADILD- 99
            ::|||.|.......::| .:|....|.::|:     :.|.:  .||:.|      .||.||:.| 
plant    13 VVTGGRGFAARHLVEML-VRYEMFCVRIADLAPAIMLDPQEGNGVLDEGLRSGRVQYISADLRDK 76

  Fly   100 ------FKGLQKIVVDHRIDWLIHFSALLSAVGEQNVPLAVRVNIEGVHNVIELAKQYKLRIFVP 158
                  |:|.:.:         .|.:|..|::  .|..|...||::|..|||:..          
plant    77 SQVVKAFQGAEVV---------FHMAAPDSSI--NNHQLQYSVNVQGTQNVIDAC---------- 120

  Fly   159 STIGAFGPDSPRNPTPNVTIQRPRTIYGVSKVHAELIGEYYYHKFGLDFRCLRFPGVISSDPPG- 222
                             |.:...|.||..|                        |.|:.....| 
plant   121 -----------------VDVGVKRLIYTSS------------------------PSVVFDGVHGI 144

  Fly   223 -GGTTDYAVAVFH-----------EAL------RNGKYTCYLRPDT 250
             .||...|..:.|           |.|      |||..||.:||.:
plant   145 LNGTESMAYPIKHNDSYSATKAEGEELIMKANGRNGLLTCCIRPSS 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TdhNP_649230.1 TDH_SDR_e 47..351 CDD:187580 51/241 (21%)
3BETAHSD/D2NP_180194.2 3b-HSD-NSDHL-like_SDR_e 11..358 CDD:187673 51/241 (21%)
Reticulon 384..539 CDD:460562
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.