DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5955 and HSD3B7

DIOPT Version :9

Sequence 1:NP_649230.1 Gene:CG5955 / 40268 FlyBaseID:FBgn0036997 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_079469.2 Gene:HSD3B7 / 80270 HGNCID:18324 Length:369 Species:Homo sapiens


Alignment Length:161 Identity:44/161 - (27%)
Similarity:65/161 - (40%) Gaps:22/161 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LITGGLGQLGIECAKLL---RTQYGSQNVILSDIIKPSQSVLENGPY----IFADILDFKGLQKI 106
            |:|||.|.||....::|   ..:.|...| ....:.|....|:.||.    |..|:.....:...
Human    13 LVTGGCGFLGEHVVRMLLQREPRLGELRV-FDQHLGPWLEELKTGPVRVTAIQGDVTQAHEVAAA 76

  Fly   107 VVDHRIDWLIHFSALLSAVGEQNVPLAVRVNIEGVHNVIELAKQYKLRIFV-PSTIGAFGPDSPR 170
            |....:  :||.:.|:...|..:......||::|..||||...|...|..| .|::...||::..
Human    77 VAGAHV--VIHTAGLVDVFGRASPKTIHEVNVQGTRNVIEACVQTGTRFLVYTSSMEVVGPNTKG 139

  Fly   171 NP-------TPNVTIQR-PRTIYGVSKVHAE 193
            :|       ||...:.| |   |..||..||
Human   140 HPFYRGNEDTPYEAVHRHP---YPCSKALAE 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5955NP_649230.1 WcaG 47..355 CDD:223528 44/161 (27%)
TDH_SDR_e 47..351 CDD:187580 44/161 (27%)
HSD3B7NP_079469.2 3b-HSD_HSDB1_like_SDR_e 11..361 CDD:187671 44/161 (27%)
3Beta_HSD 13..291 CDD:279420 44/161 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.