DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5955 and Sdr42e1

DIOPT Version :9

Sequence 1:NP_649230.1 Gene:CG5955 / 40268 FlyBaseID:FBgn0036997 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001344201.1 Gene:Sdr42e1 / 74032 MGIID:1921282 Length:394 Species:Mus musculus


Alignment Length:313 Identity:77/313 - (24%)
Similarity:114/313 - (36%) Gaps:83/313 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PRESRPPKILITGGLGQLG--IECAKLLRTQYGSQNVILSDIIKPSQSVLENGPYIFADILDFKG 102
            |.|:    :|||||.|..|  :.||   ..|.|:: |||.||.:|:|::.|...::..||.....
Mouse     7 PEET----VLITGGGGYFGFRLGCA---LNQKGAR-VILFDITQPAQNLPEGIKFVCGDIRCLAD 63

  Fly   103 LQKIVVD-HRIDWLIHFSAL-LSAVGEQNVPLAVRVNIEGVHNVIELAKQYKL-RIFVPSTIGA- 163
            ::....| .::..:.|.::. :|...:.|......||:.|..|::....:..: |:...||... 
Mouse    64 VETAFQDAEKVACVFHVASYGMSGREQLNKTQIEEVNVGGTENILRACLERGVPRLVYTSTFNVI 128

  Fly   164 FGPDSPRN---PTPNVTIQRPRTIYGVSKVHAELIGEYYYHKFGLDFRCLRFPGVISSDPPGGGT 225
            ||....||   ..|.:.:......|..:|..||   :......||.|:            .|.| 
Mouse   129 FGGQVIRNGDESLPYLPLHLHPDHYSRTKSIAE---KKVLEANGLAFK------------QGDG- 177

  Fly   226 TDYAVAVFHEALRNGKYTCYLRP--------DTRLP--MMYIEDCLRALLEFMRAPNEQLKRRVY 280
                      .||    ||.:||        ...||  :.|||   |.|..|:....:.|...| 
Mouse   178 ----------ILR----TCAIRPAGIYGAGEQRHLPRIVSYIE---RGLFRFVYGDPQSLVEFV- 224

  Fly   281 NVTAMSFTPEELFAQLGKHVPNLHVTYKPDSRQLIAD----AWPQVFDDSDAR 329
                              ||.||...:...|..|.||    |..|.:..||.|
Mouse   225 ------------------HVDNLAKAHILASEALKADKGHVASGQPYFISDGR 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5955NP_649230.1 WcaG 47..355 CDD:223528 75/306 (25%)
TDH_SDR_e 47..351 CDD:187580 75/306 (25%)
Sdr42e1NP_001344201.1 NADB_Rossmann 10..351 CDD:389744 75/310 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.