DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5955 and GFUS

DIOPT Version :9

Sequence 1:NP_649230.1 Gene:CG5955 / 40268 FlyBaseID:FBgn0036997 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001304712.1 Gene:GFUS / 7264 HGNCID:12390 Length:327 Species:Homo sapiens


Alignment Length:352 Identity:75/352 - (21%)
Similarity:118/352 - (33%) Gaps:107/352 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KILITGGLGQLGIECAKLLRTQYGSQNVILSDIIKPSQSVLENG------PYIF-----ADILDF 100
            :||:|||.|.:|                      |..|.|:.:|      .::|     ||:.|.
Human    15 RILVTGGSGLVG----------------------KAIQKVVADGAGLPGEDWVFVSSKDADLTDT 57

  Fly   101 KG----LQKIVVDHRIDWLIHFSALLSAVGEQNVPLAVRVNIE----GVH---NVIELAKQYKLR 154
            ..    .:|:...|    :||.:|::..:...     ::.|::    .||   ||:..|.:...|
Human    58 AQTRALFEKVQPTH----VIHLAAMVGGLFRN-----IKYNLDFWRKNVHMNDNVLHSAFEVGAR 113

  Fly   155 IFVPSTIGAFGPDSPRNPTPNVTIQR--PRTI---YGVSKVHAELIGEYYYHKFGLDFRCLRFPG 214
            ..|........||....|.....|..  |...   |..:|...::....|:.::|    | .|..
Human   114 KVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYG----C-TFTA 173

  Fly   215 VISSDPPG---------GGTTDYAVAVFHEALRNGK-YTCYLRPDTRLPMMYIEDCLRALLEFMR 269
            ||.::..|         |......:...|.|..:|. .|.:...:.|...:|..|..:..:..:|
Human   174 VIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLR 238

  Fly   270 APNE--------------QLKRRVYNVT-AMSFTPEELF------AQLGKHVPNLHV-TYKPDSR 312
            ..||              .:|.....|. ||.|..|..|      .|..|...|..: ||.||.|
Human   239 EYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFR 303

  Fly   313 -----QLIAD--AWPQVFDDS--DARR 330
                 |.:.:  ||   |.|:  .||:
Human   304 FTPFKQAVKETCAW---FTDNYEQARK 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5955NP_649230.1 WcaG 47..355 CDD:223528 75/352 (21%)
TDH_SDR_e 47..351 CDD:187580 75/352 (21%)
GFUSNP_001304712.1 GDP_FS_SDR_e 15..318 CDD:187550 71/341 (21%)
Epimerase 16..251 CDD:279681 53/270 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.