DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5955 and gfus.3

DIOPT Version :9

Sequence 1:NP_649230.1 Gene:CG5955 / 40268 FlyBaseID:FBgn0036997 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001070752.2 Gene:gfus.3 / 550486 ZFINID:ZDB-GENE-050417-317 Length:344 Species:Danio rerio


Alignment Length:386 Identity:74/386 - (19%)
Similarity:126/386 - (32%) Gaps:154/386 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IPLPRITPIASQLVQRRAFHQVPR----ESR--------PPKILITGGLGQLGIECAKLLRTQ-- 68
            :|||                |.||    :||        |.::|:|||.|.:|....::::.:  
Zfish     8 LPLP----------------QSPRTDGEQSREKMNGTVEPMRVLVTGGSGLVGRAIERVVKEEGR 56

  Fly    69 YGSQNVILSDIIKPSQSVLENGPYIFADILDFKGLQKIVVDHRIDWLIHFSALLSAV---GEQNV 130
            .|.:...||     |:.         |::|..|..:.|...:|...:||.:|::..:   ..||:
Zfish    57 GGEEWTFLS-----SKE---------ANLLSAKETRAIFEKYRPTHVIHLAAMVGGLFRNMRQNL 107

  Fly   131 PLAVRVNIEGVHNVIELAKQYKLRIFVPSTIGAFGPDSPRNPTPNVTIQRPRTIYGVSKVHAELI 195
            .. .|.|:....||::.|.::.:...|........||              :|.|.:.:.     
Zfish   108 DF-WRNNVFINDNVLQTANEFGVVKVVSCLSTCIFPD--------------KTTYPIDET----- 152

  Fly   196 GEYYYHKFGLDFRCLRFPGVISSDPPGGGTTDYAVAVFHEALRNGKYTCYLRPDTRLPMMYIEDC 260
                               :|.:.||......||.|.....::|  .||:               
Zfish   153 -------------------MIHNGPPHDSNFGYAFAKRMIDVQN--RTCF--------------- 181

  Fly   261 LRALLEFMRAPNEQLKRRVYNVTAMSFTPEELFAQLGKH----------VPNL-HVTY--KPDSR 312
                        :|..||        :|...|....|.|          :|.| |.||  |.:.:
Zfish   182 ------------KQYGRR--------YTAGILTNVFGAHDNFNIEDGHVLPGLIHKTYLAKKEGK 226

  Fly   313 QLIADAWPQVFDDSDARRDWHWQHKYDLSNLVDFMIKDVQDNYINVQP------EQQTLQI 367
            .|      ||:......|  .:.:..||:.|..:::::    |..|.|      |:..|.|
Zfish   227 PL------QVWGSGKPLR--QFIYSLDLARLFLWVLRE----YDEVDPIILSVGEEDELSI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5955NP_649230.1 WcaG 47..355 CDD:223528 59/325 (18%)
TDH_SDR_e 47..351 CDD:187580 59/321 (18%)
gfus.3NP_001070752.2 GDP_FS_SDR_e 33..335 CDD:187550 65/345 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.