DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5955 and mat2b

DIOPT Version :9

Sequence 1:NP_649230.1 Gene:CG5955 / 40268 FlyBaseID:FBgn0036997 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_005161452.1 Gene:mat2b / 541347 ZFINID:ZDB-GENE-030131-786 Length:334 Species:Danio rerio


Alignment Length:350 Identity:74/350 - (21%)
Similarity:123/350 - (35%) Gaps:85/350 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QLVQRRAFHQVPRESRPPKILITGGLGQLGIECAKLLRTQYGSQNVILSDIIKPSQSVLENG--- 90
            :|||...:....|      :|:||..|.||              ..:..:........|..|   
Zfish    18 ELVQDEVYTPYRR------VLVTGATGLLG--------------RAVYKEFKNNDWDALGCGYNR 62

  Fly    91 --PYIF-ADILDFKGLQKIVVDHRIDWLIHFSA-LLSAVGEQNVPLAVRVNIEGVHNVIELAKQ- 150
              |:.. .::||...::.::...:...::|.:| ....|.|::...|:.:|   ||....|||: 
Zfish    63 ARPFFLKCNLLDEDAVRGVIQRFQPHVIVHCAAERRPDVVERHTEAAMNLN---VHACATLAKEA 124

  Fly   151 ---YKLRIFVPSTIGAFGPDSPRNPTPNVTIQRPRTIYGVSKVHAELIGEYYYHKFGLDFRCLRF 212
               :.:.|..........|....|..||     |..:||.||:..|  .|...|..|.  ..||.
Zfish   125 GGSFLIYISTDYVFDGRNPPYGENDAPN-----PLNLYGKSKLEGE--REILRHCPGA--AILRV 180

  Fly   213 P---GVISSDPPGGGTTDYAVAVFHEALRNGKYTCYL-RPDTRLPMMYIEDCLRALLEFM-RAPN 272
            |   |.:..      ..:.||.|..|.::.|..:|.: ....|.| .|..|..|...... ||..
Zfish   181 PILFGEVEK------VEESAVTVLFERVQEGAESCTIDHCQQRFP-TYTNDVARVCRNMAERALQ 238

  Fly   273 EQLKRRVYNVTAM-SFTPEELFAQLGK--HVPNLHV-----------TYKPDSRQ---------- 313
            :|..|.:::.:|. ..|..|:...:..  ::|:.|:           ..:|.:.|          
Zfish   239 DQSLRGIFHYSAKEQMTKYEMTCAIADAFNLPSSHLIPMTEQPAGAGAQRPQNAQLECSRLELLG 303

  Fly   314 LIADAWPQVFDDSDARRD--WHWQH 336
            |..::.|    ..:|.||  |.:||
Zfish   304 LSVESTP----FKNAIRDSLWPFQH 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5955NP_649230.1 WcaG 47..355 CDD:223528 69/331 (21%)
TDH_SDR_e 47..351 CDD:187580 69/331 (21%)
mat2bXP_005161452.1 dTDP_HR_like_SDR_e 30..316 CDD:187564 66/328 (20%)
RmlD_sub_bind 31..322 CDD:282214 68/327 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.