DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5955 and gfus.2

DIOPT Version :9

Sequence 1:NP_649230.1 Gene:CG5955 / 40268 FlyBaseID:FBgn0036997 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001003528.1 Gene:gfus.2 / 445134 ZFINID:ZDB-GENE-041014-242 Length:328 Species:Danio rerio


Alignment Length:180 Identity:34/180 - (18%)
Similarity:69/180 - (38%) Gaps:42/180 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PPKILITGGLGQLGIECAKLLRTQYGSQNVILSDIIKPSQSVLENGPYIF-----ADILDFKGLQ 104
            |.::|:|||.|.:|....::::...|.                |...:||     |:::..:..:
Zfish    14 PMRVLVTGGSGLVGRAIERVVKEGEGR----------------EGEEWIFLSSKEANLVSAEQTR 62

  Fly   105 KIVVDHRIDWLIHFSALLSAVGEQNVPLAVRVNIE----GVH---NVIELAKQYKLRIFVPSTIG 162
            .....||...:||.:|::..:...     :|.|::    .||   ||:.::.::.:...|.....
Zfish    63 AAFEKHRPTHVIHLAAMVGGLYRN-----MRQNLDFWRNNVHINDNVLNMSHEFGVVKVVSCLST 122

  Fly   163 AFGPDSPRNPTPNVTIQ--RPR-TIYGVS------KVHAELIGEYYYHKF 203
            ...||..:.|.....:.  .|. :.||.:      .||...:.:.|..|:
Zfish   123 CVFPDKTKYPIDETMMHDGAPHDSNYGYAYAKRMIDVHNRALYQQYGRKY 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5955NP_649230.1 WcaG 47..355 CDD:223528 33/178 (19%)
TDH_SDR_e 47..351 CDD:187580 33/178 (19%)
gfus.2NP_001003528.1 GDP_FS_SDR_e 16..319 CDD:187550 33/178 (19%)
Epimerase 17..249 CDD:279681 33/177 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.