DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5955 and Uxs

DIOPT Version :9

Sequence 1:NP_649230.1 Gene:CG5955 / 40268 FlyBaseID:FBgn0036997 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_648182.1 Gene:Uxs / 38911 FlyBaseID:FBgn0035848 Length:441 Species:Drosophila melanogaster


Alignment Length:315 Identity:73/315 - (23%)
Similarity:125/315 - (39%) Gaps:45/315 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KILITGGLGQLGIECAKLLRTQYGSQNVILSDIIKPSQSVL------ENGPYIFADILDFKGLQK 105
            :||||||.|.:|......|..| |.:.:::.:.....:..:      ||...|..||::     .
  Fly   117 RILITGGAGFVGSHLVDDLMVQ-GHEVIVVDNFFTGRKRNVEHWLGHENFELIHHDIVN-----P 175

  Fly   106 IVVDHRIDWLIHFSALLSAVGEQNVPL-AVRVNIEGVHNVIELAKQYKLRIFVPSTIGAFGPDSP 169
            :.::  ||.:.|.::..|.......|: .::.|..|..||:.|||:...::.:.||...:| |..
  Fly   176 LFIE--IDEIYHLASPASPPHYMYNPVKTIKTNTMGTINVLGLAKRVMAKVLIASTSEVYG-DPT 237

  Fly   170 RNPTP-----NVTIQRPRTIYGVSKVHAELIGEYYYHKFGLDFRCLRF-----PGVISSDPPGGG 224
            .:|.|     :|....||..|...|..:|.:...|..:..:..|..|.     |.:..:|  |..
  Fly   238 VHPQPETYWGHVNPIGPRACYDEGKRVSETLSYAYAKQEKVQVRVARIFNTYGPRMHMND--GRV 300

  Fly   225 TTDYAVAVFHEALRNGKYTCYLRPDTRLPMMYIEDCLRALLEFMRAPNEQLKRRVYNVTAMSFTP 289
            .:::.:    :||||...|.|..........|:.|.:..::..| |.|       |........|
  Fly   301 VSNFIL----QALRNETITVYGNGKQTRSFQYVSDLVDGMIALM-ASN-------YTQPVNLGNP 353

  Fly   290 EEL----FAQLGKHVPNLHVTYKPDSRQLIADAWPQVFDDSDARRDWHWQHKYDL 340
            .|.    ||::.|.:.......| .|:.:..|...:..|.:.||:..||:.|..|
  Fly   354 VEQTIGEFAEIIKKLVGGPSVIK-QSKAMEDDPQRRKPDITRARQLLHWEPKVPL 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5955NP_649230.1 WcaG 47..355 CDD:223528 73/315 (23%)
TDH_SDR_e 47..351 CDD:187580 73/315 (23%)
UxsNP_648182.1 WcaG 116..424 CDD:223528 73/315 (23%)
UGD_SDR_e 116..419 CDD:187541 73/315 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466368
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.