DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5955 and hsd3b2

DIOPT Version :9

Sequence 1:NP_649230.1 Gene:CG5955 / 40268 FlyBaseID:FBgn0036997 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_997962.1 Gene:hsd3b2 / 373131 ZFINID:ZDB-GENE-030828-2 Length:374 Species:Danio rerio


Alignment Length:304 Identity:66/304 - (21%)
Similarity:112/304 - (36%) Gaps:75/304 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LITGGLGQLGIECAKLLRTQYGSQNV------ILSDIIKPSQSVLENG------PYIFADILDFK 101
            ::||..|.||.:..:||..:.....:      |.|::|:    .||:|      ..|..||.|.:
Zfish     9 VVTGACGFLGEKLVRLLLEEENLSEIRLLDRNIRSELIQ----TLEDGRGETKVSVIEGDIRDRE 69

  Fly   102 GLQKIVVDHRIDWLIHFSALLSAVGEQNVPLAVRVNIEGVHNVIELAKQYKLRIFV-PSTIGAFG 165
            .|::......:  :.|.::|:...|.........||::....::|...|..:..|: .|:|....
Zfish    70 LLRRACKGATL--VFHTASLIDYNGAVEYSELHAVNVKATRLLLETCIQQSVSSFIYTSSIEVAC 132

  Fly   166 PDSPRNPTPNVTIQRPRTIYGVS-----KVHAELIGEYYYHKFGLDFRCLRFPGVISSDPPGGGT 225
            |:....|..|.....|.:.|.:|     |..||.|             ||:..|           
Zfish   133 PNRSGEPIINGHEDTPYSSYPISNYSKTKQEAEQI-------------CLQANG----------- 173

  Fly   226 TDYAVAVFHEALRNGKY--TCYLRPDTRLPMMYIEDC---LRALLEFMRAPNEQLKRRVYNVTAM 285
                     |.||:|.:  ||.|||    ..:|...|   |..|.:.:|:.|.|     :.::..
Zfish   174 ---------ELLRDGGHLATCALRP----MFIYGPGCRFTLNKLRDAIRSGNVQ-----HRLSQQ 220

  Fly   286 SFTPEELF---AQLGKHVPNLHVTYKPDSRQLIADAWPQVFDDS 326
            |.....::   |.|. |:........|:.|.::...:..|.||:
Zfish   221 SAKVNPVYVGNAALA-HLQAGRALRDPEKRAVVGGNFYYVSDDT 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5955NP_649230.1 WcaG 47..355 CDD:223528 66/304 (22%)
TDH_SDR_e 47..351 CDD:187580 66/304 (22%)
hsd3b2NP_997962.1 NADB_Rossmann 7..359 CDD:304358 66/304 (22%)
3Beta_HSD 9..290 CDD:279420 66/304 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.