DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5955 and Gmd

DIOPT Version :9

Sequence 1:NP_649230.1 Gene:CG5955 / 40268 FlyBaseID:FBgn0036997 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_608888.2 Gene:Gmd / 33716 FlyBaseID:FBgn0031661 Length:395 Species:Drosophila melanogaster


Alignment Length:393 Identity:79/393 - (20%)
Similarity:131/393 - (33%) Gaps:130/393 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ESRPPKILITGGLGQLGIECAK-LLRTQYGSQNVILSDIIKPSQSVLENGPYIFA---------- 95
            :||....||||..||.|...|: ||:..|....:|.    :.|........:::|          
  Fly    43 DSRDKVALITGITGQDGSYLAEFLLKKDYEVHGIIR----RASTFNTTRIEHLYADPKAHKGGRM 103

  Fly    96 -----DILDFKGLQKIV----------------VDHRIDWLIHFSALLSAVGEQNVPLAVRVNIE 139
                 |:.|...|.||:                |....| |..::|.:.|||...:..|:|.   
  Fly   104 KLHYGDMTDSSSLVKIINMVKPTEIYNLAAQSHVKVSFD-LSEYTAEVDAVGTLRILDAIRT--- 164

  Fly   140 GVHNVIELAKQYKLRIFVPSTIGAFGP--DSPRN-PTPNVTIQRPRTIYGVSKVHAELI------ 195
                   ...:..:|.:..||...:|.  ::|:| .||..    ||:.|..:|::...|      
  Fly   165 -------CGMEKNVRFYQASTSELYGKVVETPQNEQTPFY----PRSPYACAKMYGFWIVINYRE 218

  Fly   196 -------------------GEYY------------YHK----FGLDFRCLRFPGVISSDPPGGGT 225
                               ||.:            |||    |.|        |.:.|....|..
  Fly   219 AYNMYACNGILFNHESPRRGENFVTRKITRSVAKIYHKQMEYFEL--------GNLDSKRDWGHA 275

  Fly   226 TDYAVAVFHEALRNGKYTCYLRPDTRLPMMYI--EDCLRALLEFMRAPNEQLKRRVYNVTAMSFT 288
            :||..|::....|..            |..|:  .....::.||:.|..:.:.|   .:|.....
  Fly   276 SDYVEAMWMMLQRES------------PSDYVIATGETHSVREFVEAAFKHIDR---EITWKGKG 325

  Fly   289 PEELFAQLGKHVPNLHVT---YKPDSRQLIADAWPQVFDDSDARRDWHWQHKYDLSNLVDFMIK- 349
            .:|:..:.|..:..:.:.   ::|....|:..      |.|.|.|:.:|..|.....||..|:| 
  Fly   326 VDEVGVENGTGIVRVRINPKYFRPTEVDLLQG------DASKANRELNWTPKVTFVELVSDMMKA 384

  Fly   350 DVQ 352
            |::
  Fly   385 DIE 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5955NP_649230.1 WcaG 47..355 CDD:223528 77/388 (20%)
TDH_SDR_e 47..351 CDD:187580 76/385 (20%)
GmdNP_608888.2 NADB_Rossmann 47..389 CDD:304358 77/389 (20%)
GDP_Man_Dehyd 50..381 CDD:292973 74/378 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466364
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.